DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4318 and klu-2

DIOPT Version :9

Sequence 1:NP_572860.2 Gene:CG4318 / 32266 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_491843.3 Gene:klu-2 / 172339 WormBaseID:WBGene00022592 Length:386 Species:Caenorhabditis elegans


Alignment Length:166 Identity:43/166 - (25%)
Similarity:63/166 - (37%) Gaps:28/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 MNYEEEGS--------NDSDVELIEPV----DGSQEMETIDLTIDSPGDNVENMCPNSNSNGNGN 134
            :|.|.|.|        :.|..|:::.|    .||          .|..:|:.|....:.:...|:
 Worm   177 LNIEHEKSAFEIVSCHHQSAEEILQRVRLGTSGS----------TSSANNLRNSLSEATTTTTGS 231

  Fly   135 VSQSSAQKDTKKKMLKKTHKCNICGKYFMLPAHLKCHMWVHAREKPYKCLQCSQSYAQIRGLRRH 199
            |..:|...|..   ....:.|.||.|.|..|..|..|...|..|||:||..|.:.:::...||.|
 Worm   232 VESTSGTADGS---APGQYYCFICEKDFRRPDILSRHTRRHTGEKPFKCEDCGRFFSRSDHLRTH 293

  Fly   200 ERVHSSRPELRSYKCSRCPKIFNRNSALKNHETMHH 235
            .|.|:..   :.|.|..|.....|...|..|.:..|
 Worm   294 RRTHTDE---KPYHCCVCNYSARRRDVLTRHMSTRH 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071
C2H2 Zn finger 155..175 CDD:275368 8/19 (42%)
zf-H2C2_2 167..192 CDD:290200 9/24 (38%)
COG5048 <179..>236 CDD:227381 17/57 (30%)
C2H2 Zn finger 183..203 CDD:275368 6/19 (32%)
C2H2 Zn finger 214..234 CDD:275368 5/19 (26%)
klu-2NP_491843.3 COG5048 216..>298 CDD:227381 25/84 (30%)
C2H2 Zn finger 249..269 CDD:275368 8/19 (42%)
zf-H2C2_2 262..286 CDD:290200 9/23 (39%)
COG5048 273..>328 CDD:227381 17/57 (30%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
zf-H2C2_2 289..314 CDD:290200 8/27 (30%)
C2H2 Zn finger 305..324 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166744
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.