DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4318 and Zbtb7a

DIOPT Version :9

Sequence 1:NP_572860.2 Gene:CG4318 / 32266 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_006513342.3 Gene:Zbtb7a / 16969 MGIID:1335091 Length:725 Species:Mus musculus


Alignment Length:218 Identity:57/218 - (26%)
Similarity:80/218 - (36%) Gaps:56/218 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YGMDSVQVIEQDEMVVSEMNYEEEGS----------NDSDVELIEPVDGSQEMETIDLTIDSPGD 118
            ||.......|::...:||...|...|          .|.|...::.:..|..::.:..::...||
Mouse   422 YGRAGAGTGEEEAAALSEAAPEPGDSPGFLSGAAEGEDGDAADVDGLAASTLLQQMMSSVGRAGD 486

  Fly   119 NVENMCPNSNSNG-------------NGNVSQSSAQKDTKKKMLKKTHKCNICGKYFM----LPA 166
            :.|.  ..::..|             .|:|..:.:||..||...|...||.||.|...    ||.
Mouse   487 SDEE--SRTDDKGVMDYYLKYFSGAHEGDVYPAWSQKGEKKIRAKAFQKCPICEKVIQGAGKLPR 549

  Fly   167 H------------------------LKCHMWVHAREKPYKCLQCSQSYAQIRGLRRHERVHSSRP 207
            |                        ||.||..|..||||.|.||..::|....|:.|.|||:.  
Mouse   550 HIRTHTGEKPYECNICKVRFTRQDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTG-- 612

  Fly   208 ELRSYKCSRCPKIFNRNSALKNH 230
             ||.|:|..|.|.|.|:..|..|
Mouse   613 -LRPYQCDSCCKTFVRSDHLHRH 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071 57/218 (26%)
C2H2 Zn finger 155..175 CDD:275368 11/47 (23%)
zf-H2C2_2 167..192 CDD:290200 13/48 (27%)
COG5048 <179..>236 CDD:227381 22/52 (42%)
C2H2 Zn finger 183..203 CDD:275368 7/19 (37%)
C2H2 Zn finger 214..234 CDD:275368 7/17 (41%)
Zbtb7aXP_006513342.3 BTB_POZ_ZBTB7A 165..284 CDD:349635
C2H2 Zn finger 534..554 CDD:275368 7/19 (37%)
zf-H2C2_2 549..571 CDD:404364 1/21 (5%)
C2H2 Zn finger 562..582 CDD:275368 4/19 (21%)
zf-H2C2_2 575..599 CDD:404364 12/23 (52%)
C2H2 Zn finger 590..610 CDD:275368 7/19 (37%)
zf-H2C2_2 602..627 CDD:404364 12/27 (44%)
C2H2 Zn finger 618..636 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.