DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4318 and Klf9

DIOPT Version :9

Sequence 1:NP_572860.2 Gene:CG4318 / 32266 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_034768.2 Gene:Klf9 / 16601 MGIID:1333856 Length:244 Species:Mus musculus


Alignment Length:144 Identity:35/144 - (24%)
Similarity:63/144 - (43%) Gaps:24/144 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 TIDSPGDNVENMCPNSNSNGNGNVSQSSAQKDT-----------------KKKMLKKTHKC--NI 157
            :::||.:::.:....:..:|:........::|:                 .|...:|.|||  :.
Mouse    85 SLESPDEDIGSDSDVTTESGSSPSHSPEERQDSGSAPSPLSLLHSGVASKGKHASEKRHKCPYSG 149

  Fly   158 CGKYFMLPAHLKCHMWVHAREKPYKCL--QCSQSYAQIRGLRRHERVHSSRPELRSYKCSRCPKI 220
            |||.:...:|||.|..||..|:|:.|.  .|.:.:::...|.||.|.|:..   :.::|..|.|.
Mouse   150 CGKVYGKSSHLKAHYRVHTGERPFPCTWPDCLKKFSRSDELTRHYRTHTGE---KQFRCPLCEKR 211

  Fly   221 FNRNSALKNHETMH 234
            |.|:..|..|...|
Mouse   212 FMRSDHLTKHARRH 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071
C2H2 Zn finger 155..175 CDD:275368 8/21 (38%)
zf-H2C2_2 167..192 CDD:290200 10/26 (38%)
COG5048 <179..>236 CDD:227381 16/58 (28%)
C2H2 Zn finger 183..203 CDD:275368 6/21 (29%)
C2H2 Zn finger 214..234 CDD:275368 7/19 (37%)
Klf9NP_034768.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..51
COG5048 <78..234 CDD:227381 35/144 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..143 6/57 (11%)
C2H2 Zn finger 145..167 CDD:275368 8/21 (38%)
C2H2 Zn finger 175..197 CDD:275368 6/21 (29%)
C2H2 Zn finger 205..225 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5377
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.