DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4318 and Klf16

DIOPT Version :9

Sequence 1:	NP_572860.2	Gene:	CG4318 / 32266	FlyBaseID:	FBgn0030455	Length:	236	Species:	Drosophila melanogaster
Sequence 2:	NP_510962.2	Gene:	Klf16 / 118445	MGIID:	2153049	Length:	251	Species:	Mus musculus

Alignment Length:	115	Identity:	35/115 - (30%)
Similarity:	51/115 - (44%)	Gaps:	10/115 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   127 SNSNGNGNVSQSSAQKDT---KKKMLKKTHKCNI--CGKYFMLPAHLKCHMWVHAREKPYKC--L 184
            |.:.|...||.|||....   :.....|:|:|..  |.|.:...:|||.|:..|..|:|:.|  .
Mouse    97 STAGGTSPVSSSSAASSPSSGRAPGAAKSHRCPFHGCAKAYYKSSHLKSHLRTHTGERPFACDWP 161

  Fly   185 QCSQSYAQIRGLRRHERVHSSRPELRSYKCSRCPKIFNRNSALKNHETMH 234
            .|.:.:|:...|.||.|.|:..   :.:.|..|.|.|.|:..|..|...|
Mouse   162 GCDKKFARSDELARHHRTHTGE---KRFPCPLCTKRFTRSDHLTKHARRH 208

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4318	NP_572860.2	zf-AD	5..>64	CDD:285071
		C2H2 Zn finger	155..175	CDD:275368	7/21 (33%)
		zf-H2C2_2	167..192	CDD:290200	9/26 (35%)
		COG5048	<179..>236	CDD:227381	17/58 (29%)
		C2H2 Zn finger	183..203	CDD:275368	7/21 (33%)
		C2H2 Zn finger	214..234	CDD:275368	7/19 (37%)
Klf16	NP_510962.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	48..72
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	95..125		7/27 (26%)
		COG5048	124..>186	CDD:227381	20/64 (31%)
		C2H2 Zn finger	128..150	CDD:275368	7/21 (33%)
		zf-H2C2_2	142..169	CDD:290200	9/26 (35%)
		COG5048	<158..>231	CDD:227381	16/54 (30%)
		C2H2 Zn finger	158..180	CDD:275368	7/21 (33%)
		zf-H2C2_2	172..197	CDD:290200	9/27 (33%)
		C2H2 Zn finger	188..208	CDD:275368	7/19 (37%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	201..251		3/8 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	62	1.000	Inparanoid score	I5377
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.050