DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4318 and Zbtb7a

DIOPT Version :9

Sequence 1:NP_572860.2 Gene:CG4318 / 32266 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_006240898.1 Gene:Zbtb7a / 117107 RGDID:620946 Length:648 Species:Rattus norvegicus


Alignment Length:216 Identity:58/216 - (26%)
Similarity:82/216 - (37%) Gaps:52/216 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YGMDSVQVIEQDEMVVSEMNYEEEGS----------NDSDVELIEPVDGSQEMETIDLTIDSPGD 118
            ||.......|::.:.:||...|...|          .|.|...::.:..|..::.:..::...||
  Rat   345 YGRAGASTGEEEAVALSEAAPEPGDSPGFLSGAAEGEDGDAADVDGLAASTLLQQMMSSVGRAGD 409

  Fly   119 NVENMCPNSNS---------NG--NGNVSQSSAQKDTKKKMLKKTHKCNICGKYFM----LPAH- 167
            :.|...|:...         :|  .|:|..:.:||..||...|...||.||.|...    ||.| 
  Rat   410 SDEESRPDDKGVMDYYLKYFSGAHEGDVYPAWSQKGEKKIRAKAFQKCPICEKVIQGAGKLPRHI 474

  Fly   168 -----------------------LKCHMWVHAREKPYKCLQCSQSYAQIRGLRRHERVHSSRPEL 209
                                   ||.||..|..||||.|.||..::|....|:.|.|||:.   |
  Rat   475 RTHTGEKPYECNICKVRFTRQDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTG---L 536

  Fly   210 RSYKCSRCPKIFNRNSALKNH 230
            |.|:|..|.|.|.|:..|..|
  Rat   537 RPYQCDSCCKTFVRSDHLHRH 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071 58/216 (27%)
C2H2 Zn finger 155..175 CDD:275368 11/47 (23%)
zf-H2C2_2 167..192 CDD:290200 13/48 (27%)
COG5048 <179..>236 CDD:227381 22/52 (42%)
C2H2 Zn finger 183..203 CDD:275368 7/19 (37%)
C2H2 Zn finger 214..234 CDD:275368 7/17 (41%)
Zbtb7aXP_006240898.1 BTB 103..206 CDD:279045
BTB 114..210 CDD:197585
COG5048 455..>518 CDD:227381 20/62 (32%)
C2H2 Zn finger 457..477 CDD:275368 7/19 (37%)
zf-H2C2_2 472..494 CDD:290200 1/21 (5%)
C2H2 Zn finger 485..505 CDD:275368 4/19 (21%)
zf-H2C2_2 498..522 CDD:290200 12/23 (52%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 525..550 CDD:290200 12/27 (44%)
C2H2 Zn finger 541..559 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344831
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.