DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4318 and LOC100362054

DIOPT Version :9

Sequence 1:NP_572860.2 Gene:CG4318 / 32266 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_038956618.1 Gene:LOC100362054 / 100362054 RGDID:2318927 Length:503 Species:Rattus norvegicus


Alignment Length:182 Identity:41/182 - (22%)
Similarity:73/182 - (40%) Gaps:23/182 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DSVQVIEQDEMVVSEMNYEEEG-SNDSDVELIEPVDGSQE------METIDLTI-------DSPG 117
            ||:.:|::::....:|.....| ..|..:.:.......||      .|.:.:.:       :.|.
  Rat   299 DSIFIIQREQYSEPDMEGVSYGVPQDLRIAVCGTSRSLQESLWAASSEVVPMKVPGFLSRAEQPN 363

  Fly   118 DNVENMCPNSNSNGNGNVSQSSAQKDTKKKMLKKTHKCNICGKYFMLPAHLKCHMWVHAREKPYK 182
            .....:..|...|......|...|:|      .|.:||..|.:.|..|.:|..|...|.:|:|:.
  Rat   364 PKPVPLFQNYEVNSTFEGYQERLQRD------PKPYKCEECSRTFKYPCNLSIHQKTHRKERPFF 422

  Fly   183 CLQCSQSYAQIRGLRRHERVHSSRPELRSYKCSRCPKIFNRNSALKNHETMH 234
            |.:|...:.:...|:.||.:|.:.   :.:.||.|.|.|...:.|:.||.:|
  Rat   423 CKECQVGFYEDSELQVHEVIHKAE---KPFTCSSCGKAFRYKTNLQAHERIH 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071
C2H2 Zn finger 155..175 CDD:275368 6/19 (32%)
zf-H2C2_2 167..192 CDD:290200 7/24 (29%)
COG5048 <179..>236 CDD:227381 16/56 (29%)
C2H2 Zn finger 183..203 CDD:275368 5/19 (26%)
C2H2 Zn finger 214..234 CDD:275368 8/19 (42%)
LOC100362054XP_038956618.1 SCAN 40..124 CDD:413396
zf-C2H2 393..415 CDD:395048 7/21 (33%)
C2H2 Zn finger 395..415 CDD:275368 6/19 (32%)
C2H2 Zn finger 423..471 CDD:275368 14/50 (28%)
C2H2 Zn finger 427..443 CDD:275370 3/15 (20%)
zf-C2H2 449..471 CDD:395048 8/21 (38%)
C2H2 Zn finger 479..497 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344833
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.