DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32645 and CG30467

DIOPT Version :9

Sequence 1:NP_727670.1 Gene:CG32645 / 32264 FlyBaseID:FBgn0052645 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_611044.1 Gene:CG30467 / 36719 FlyBaseID:FBgn0050467 Length:521 Species:Drosophila melanogaster


Alignment Length:272 Identity:53/272 - (19%)
Similarity:89/272 - (32%) Gaps:86/272 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 TSSGIGCASSDYSDTMTAHDDPLKQSD-HSQSSNSLKQLDALVLNLPPNDNDSGNGHHHDHDAEH 387
            ::||:..|:.. :|..:|.:...|:|| ::.:|.|.....    ..||...:         |||.
  Fly     9 SASGLAVAAKQ-NDVPSAENSNHKESDAYASASASASSAS----TTPPPAQE---------DAEE 59

  Fly   388 DHHDHHRSGS-----------------------NNSNSDEHLEGHLHEPEKLSIYSE---LLLSF 426
            ........|.                       .:|..|:.||..|.:...:|:..|   |||..
  Fly    60 AELLERMRGDAVGNTMYSSRFILKTVMRVGELLRHSTLDQQLEDDLCKVWDMSVSPEVVTLLLEN 124

  Fly   427 SAIT----NFNAICDRNVGADTIPCIHGLRAFSMAWVILGHTCIVV----------------FKY 471
            .||.    ...|.|:            .:|.:.:...:||:.|..|                ||.
  Fly   125 GAIDPIMYTLVAGCE------------DVRLYEILIGLLGNMCAQVECAEILACDRYTLETLFKM 177

  Fly   472 SDNMEMRKEVEQNFFFQAITNGPFSVDTFFFISGFLISYIYFRTNAK--GKLNKLS--------- 525
            :..|:....::....||.|.....|....|.::.: |.:..|..:|:  |::.:||         
  Fly   178 TYCMDTAMLIQLMRLFQYIMAHVLSGKEKFAVNWY-ICFAAFENSAQNLGRILQLSVSDELLVAA 241

  Fly   526 -KGANEFTAGTA 536
             |..|...|..|
  Fly   242 LKATNAVLASCA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32645NP_727670.1 NRF 121..272 CDD:214781
Acyl_transf_3 445..831 CDD:280013 23/120 (19%)
OafA 450..853 CDD:224748 23/115 (20%)
CG30467NP_611044.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3700
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.