DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32645 and CG9447

DIOPT Version :9

Sequence 1:NP_727670.1 Gene:CG32645 / 32264 FlyBaseID:FBgn0052645 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_610243.4 Gene:CG9447 / 35597 FlyBaseID:FBgn0033110 Length:656 Species:Drosophila melanogaster


Alignment Length:606 Identity:143/606 - (23%)
Similarity:241/606 - (39%) Gaps:109/606 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 LFEIYLRRKLKEALRRQDKEMMNNSETSSGIGCASSDYSDTMTAHDDPLKQSDHSQSSNSLKQ-- 360
            |...|.:...::|: ..|:::.|.....   ||.:..:|:..:.....|.:...|.|...||.  
  Fly    88 LISYYDKVHRRDAM-NSDRDLFNKEVVK---GCLNQKFSEKFSLRTRSLIEYCVSASDKDLKMDL 148

  Fly   361 LD---------ALVLNLPPNDNDSGNGHHHDHDAEHDHHDHHRSGSNNSNSDEHLEGHLHEPEKL 416
            ||         .|.:.|..:..|                  :|....||...|            
  Fly   149 LDLAFYGILVVILFITLCSSFLD------------------YRLSKMNSQKSE------------ 183

  Fly   417 SIYSE--------LLLSFSAITNFNAICD---RNVGADTIPCIHGLRAFSMAWVILGHTCIVVFK 470
            |.|.|        ||.|||.:.|::.:.:   .:...| :....|.|...:..||||||.:|...
  Fly   184 SFYREPLMDRRQRLLTSFSVVRNYHRLVEPYNSDFSRD-VSFFDGFRVIGVFVVILGHTLMVFMT 247

  Fly   471 YS-DNMEMRKEVEQNFFFQAITNGPFSVDTFFFISGFLISYIYF--RTNAKGKLNKLSKGANEFT 532
            .. :|.|..::....|......||...:..||.:||||: |:.|  |...:.|...|.       
  Fly   248 VPIENPEFFEQFLFRFETSIFQNGSLVIQIFFVMSGFLL-YVKFTKRQQIQPKTGTLE------- 304

  Fly   533 AGTAHFFGLVAYRFMRLTAPYLFVL----GVVQVTMKYLATYSIFDPPTMDHIT------CPDYW 587
             ..|.:|.:.:||:.|| .|.|..|    |.:.|.::        :.|...|:|      |...|
  Fly   305 -CIAVYFRVFSYRYFRL-LPSLLALILFNGTLLVRLQ--------NGPFWRHLTEAERVFCRANW 359

  Fly   588 WRNILYINTLFPVDEMCMLWSWYLANDTQFYMIGAIILIVGVRHFKLSAITTLVFLVLSWITTAV 652
            |:|:.:: |...:::.|...:|||..|.|.:.:..|::|:..:|.||:.......|.|::...||
  Fly   360 WKNVFFV-TNHMLEDSCSHQTWYLGADMQLFELFLIVIIITKKHPKLTRTIYTTLLALAFAVPAV 423

  Fly   653 IAFT------NNHRPNTDDPLAL-----FDKIYDKPWTRLGPYLIGMAVGWILFRT---NCKIRL 703
            :.:.      .:.||.|...|..     |.::|...:|.||.||.|...|....|.   |.:: |
  Fly   424 LTYVLELDGIYHIRPETYRYLYFRHSDTFYQMYPPFYTNLGGYLFGFLCGHFYLRQRSGNVEL-L 487

  Fly   704 PKLTVATA-WTLAMLNLFVLVFG--LYKADLSQ--FTAAAYSSLSHSAWALSLAWITIACSTGYG 763
            ..|....| |.|.:..|.||..|  ..:.|.::  ...|.|:.:....|.|..|...|......|
  Fly   488 GHLKYDLAMWLLVLATLGVLFSGYIFIRQDFAKPSLWLALYAGIHKILWVLICAGFVILMCRKVG 552

  Fly   764 GYINSLLSAPCLYPFSRVTYCAYLVHPIVIRSMALNSDAPLHLGGDLMVVMFFGLTVASYFLSFV 828
            |......:.|...|.:|:::.::|.|.:|:|::|.|...|:::....::...|.:.:.:.|::.:
  Fly   553 GIAYDFCTLPAFRPLARISFQSFLWHIVVLRTVAGNFRQPVYVSSFFLLCNVFSVFILTQFVAAL 617

  Fly   829 VSMSFEAPVVTMLKILSPSRK 849
            |::..|.|.|.:|:.|....|
  Fly   618 VAVLLEYPFVEVLRCLIKPEK 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32645NP_727670.1 NRF 121..272 CDD:214781
Acyl_transf_3 445..831 CDD:280013 105/417 (25%)
OafA 450..853 CDD:224748 111/432 (26%)
CG9447NP_610243.4 Acyl_transf_3 222..611 CDD:280013 103/408 (25%)
OafA 225..631 CDD:224748 108/425 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.