DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32645 and oac-27

DIOPT Version :9

Sequence 1:NP_727670.1 Gene:CG32645 / 32264 FlyBaseID:FBgn0052645 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_493093.1 Gene:oac-27 / 185604 WormBaseID:WBGene00009609 Length:669 Species:Caenorhabditis elegans


Alignment Length:406 Identity:81/406 - (19%)
Similarity:154/406 - (37%) Gaps:111/406 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 NFFFQAITNGPFSVDTFFFISGFLISYIYFRTNAKGKLNKLSKGANEFTAGTAHFFGLVA---YR 545
            :|:..|..||...||.||.:||||:..:            |.:..||      ..|.|:.   |:
 Worm    26 HFYPGAFPNGYLGVDQFFVLSGFLMCML------------LRRSENE------PAFSLIRTFHYK 72

  Fly   546 FMRLTAPYLFVLGVVQVTMKYLATYSIFDPPTMD----HITCPDYWWRNILYI----NTL----F 598
            .::...|..|::    :....:..||.|...::|    ..|      |.:.:|    :||    |
 Worm    73 RLKRILPLYFLV----ILAGMIGLYSFFPDISIDSNQKSAT------RALFFISNRASTLEDDYF 127

  Fly   599 PVDEMCM---LWSWYLANDTQFYMIGAIILIVGVR--------HFKLSAITTLVFLVLSWITTAV 652
            .:..|.|   ..:|.|:.:.|||::...:.::|.:        ::.:..:.:.:|...|   .|.
 Worm   128 SMLSMAMDIFTHTWSLSVEVQFYVLVPSMYLIGTKLPAKLHNPYYTIIGLASYLFFHFS---PAP 189

  Fly   653 IAFTNNHRPNTDDPLALFDKIYDKPWTRLGPYLIGMA---VGWILFRTNCKIRLP-----KLTVA 709
            :||        :..||           |:..::|||.   :|....:.:.||...     ||..:
 Worm   190 VAF--------NSVLA-----------RIWQFIIGMLIYNIGCSKLKRHYKILTDQEEKCKLQES 235

  Fly   710 TAWTLAMLNLFVLVFGLYKADLSQFTAAAYSSLSHSAWALSLAWITIACSTGYGGYINSLLSAPC 774
            ....:.:..|.::.|         |.....:|:......:....:.:.|..      |.:||...
 Worm   236 YKSYIFLAALTIMAF---------FPIPLDASIIRPLVTIGTGCLMLTCEG------NPMLSNKI 285

  Fly   775 LYPFSRVTYCAYLVH-PI-VIRSMALNSDAPL----HLGGDLMVVMFFG------LTVASYFLSF 827
            |.....::|..||:| || ....:..|.|:.|    .:...::.::||.      |.:::..||.
 Worm   286 LTYLGDISYSLYLIHWPIYAYWKLTCNGDSSLLICALISSIVLAIVFFETFEKWYLKLSNPNLSI 350

  Fly   828 VVSMSFEAPVVTMLKI 843
            :|::.|.:..:.:.||
 Worm   351 LVALLFASSGLAIEKI 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32645NP_727670.1 NRF 121..272 CDD:214781
Acyl_transf_3 445..831 CDD:280013 78/392 (20%)
OafA 450..853 CDD:224748 81/406 (20%)
oac-27NP_493093.1 OafA 1..343 CDD:224748 75/381 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.