DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32645 and oac-15

DIOPT Version :9

Sequence 1:NP_727670.1 Gene:CG32645 / 32264 FlyBaseID:FBgn0052645 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_507088.1 Gene:oac-15 / 184335 WormBaseID:WBGene00008676 Length:659 Species:Caenorhabditis elegans


Alignment Length:403 Identity:86/403 - (21%)
Similarity:135/403 - (33%) Gaps:141/403 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 IPCIHGLRAFSMAWVILGHTCIVVFKYSDNMEMRKEVEQNFFFQAITNGPFSVDTFFFISGFLIS 509
            |.|:.||..|            .||.|            :.:.....||...||.||.|||:|::
 Worm     5 IQCLRGLAIF------------FVFTY------------HLYPTIFVNGYLGVDIFFVISGYLMA 45

  Fly   510 YIYFRTNAKGKLNKLSKGANEFTAGTAHFFGLVAYRFMRLTAPYLFVLGVVQVTMKYLATYSIFD 574
                |..|..|:.|:|:           .||....||.|:...|.....|.....          
 Worm    46 ----RNLAHVKITKVSQ-----------IFGFYYRRFRRILPLYFLSTAVTLAAA---------- 85

  Fly   575 PPTMDHITCPDYWW--------------RNILYI---NTLFP---VDEMCM---LWSWYLANDTQ 616
                 |....::||              .|:|.|   |..|.   .||..:   :.:|.|..:.|
 Worm    86 -----HFYLGEFWWDVNRRYSTAATFLVTNMLLIHDSNDYFKQYLTDETSINTFIHTWSLGVEMQ 145

  Fly   617 FYMIGAIILI----------VGVRHFKLSAITTLVFLVLSWITTAVIAFTNNHRPNTDDPLALFD 671
            ||::..:|.:          ||    ||:.::.:..||:...:.....|..|..     ||.|  
 Worm   146 FYLLVPLIFVALQIGFPNNPVG----KLAIVSGISILVMCGFSLINANFAFNFM-----PLRL-- 199

  Fly   672 KIYDKPWTRLGPYLIGMAVGWILFRTNCKIRLPKLTVATAW--------TLAMLNLFVLVF---- 724
                  | :.|...:.:.:..::...:.|......||:|.|        |.:...||:.:|    
 Worm   200 ------W-QFGAGFVALFLREVITVDSVKKSKRSETVSTKWKIHESDVATCSAAVLFLCIFPAEG 257

  Fly   725 -GLYKADLSQFTAAAYSSLSHSAWALSLAWITIACSTGYGGYINSLLSAPCLYPFSRVTYCAYLV 788
             .|:...|..||.|....:.:.:..:      :.|||              |.....::|..|||
 Worm   258 DALWLRPLITFTTALLIFIENKSCGV------LKCST--------------LSYLGDISYVMYLV 302

  Fly   789 H-PIVIRSMALNS 800
            | |::  |:..||
 Worm   303 HWPVI--SLLKNS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32645NP_727670.1 NRF 121..272 CDD:214781
Acyl_transf_3 445..831 CDD:280013 86/403 (21%)
OafA 450..853 CDD:224748 84/398 (21%)
oac-15NP_507088.1 OafA 1..346 CDD:224748 86/403 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.