DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32645 and oac-5

DIOPT Version :10

Sequence 1:NP_727670.1 Gene:CG32645 / 32264 FlyBaseID:FBgn0052645 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_507114.2 Gene:oac-5 / 183069 WormBaseID:WBGene00007829 Length:709 Species:Caenorhabditis elegans


Alignment Length:35 Identity:14/35 - (40%)
Similarity:19/35 - (54%) Gaps:3/35 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 ICVQAGYILRDLRSWDDVFST---TTMLKLFSFAL 224
            ||...|.|.|||:..:.:||:   ..|||:..|.|
 Worm   183 ICHLNGVIHRDLKPENFLFSSKEENAMLKVTDFGL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32645NP_727670.1 NRF 106..245 CDD:466307 14/35 (40%)
OafA 445..851 CDD:441440
oac-5NP_507114.2 NRF 80..185 CDD:214781 1/1 (100%)
OafA 255..657 CDD:441440
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.