DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS10 and AMF1

DIOPT Version :9

Sequence 1:NP_001285188.1 Gene:MFS10 / 32263 FlyBaseID:FBgn0030452 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_015023.1 Gene:AMF1 / 854560 SGDID:S000005905 Length:515 Species:Saccharomyces cerevisiae


Alignment Length:453 Identity:91/453 - (20%)
Similarity:153/453 - (33%) Gaps:125/453 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 AP-HHNGSDPNPQKEGEFVWDEATQGLVLGSFFYGYVLTQVPGGRMAELYGGKKIYGYGVLITAV 182
            || |..|:.......|:..|..:...|.:|:|.       :..||:.:::|.||.:..|....|:
Yeast    65 APLHIIGNSFGTTNAGQLSWFASAYSLTVGTFI-------LIAGRLGDIFGHKKFFVLGFFWYAL 122

  Fly   183 FTLITPLAAHWDLPLLVLVRILEGMGEGVTYPAMHAMLAHWIPPLERNK-----FAAIVYAGSNI 242
            ::|:...:.:.:.......|..:|||.....|...|:|.....|..|..     |.|....|..:
Yeast   123 WSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFL 187

  Fly   243 GTVISMPLAGWLCSLDFLGGWPSAFYIFGLLGILWFIAWMYLVYDKPSDHPRISESEREYIER-- 305
            |.|.|..|..       |..||.|::|.|:...:..:|..:::...|.  |....|..:.:||  
Yeast   188 GAVFSSMLGQ-------LAWWPWAYWIMGIACFVLAVAGYFVIPHTPM--PSRDASSFKLLERID 243

  Fly   306 -SLQVQRLINQDLAEAEEEEGQDEVSLRAPPEEP-----------------------IPWSSLLT 346
             :..|..::...|......:| ..|..:.|....                       :|:::|.:
Yeast   244 FAGSVTGVVGLILFNFAWNQG-PVVGWQTPYTYALLIVGTFFLVIFAYIESRAAFPLLPFAALSS 307

  Fly   347 SVPLWAILLTQCGQGWA------FYT-QLTE--------------LPTYMSN---------ILHF 381
            ..   |.:|:....|||      ||| |..|              .|..:|.         :|..
Yeast   308 DT---AFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSH 369

  Fly   382 DIQSNALLNAVPYLTSWFVGIACSALADWMLARRYISLL-------------------------- 420
            ...|..:|.|:...|...:.||.:.:.....|:.::|::                          
Yeast   370 TPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQ 434

  Fly   421 -NSYKLWNTVA--SVVPSLGLIGIIY-------------VGCDWVWVTFMLAGVGSFGGAVYA 467
             .:..|.|||.  |:...||:.|.|.             ..|.| ::...|:|:|.|..|.||
Yeast   435 GLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSW-YMGIGLSGLGIFVAATYA 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS10NP_001285188.1 2A0114euk 63..547 CDD:129972 91/453 (20%)
MFS 134..538 CDD:119392 86/437 (20%)
AMF1NP_015023.1 MFS_Amf1_MDR_like 48..493 CDD:341029 88/448 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.