DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS10 and VHT1

DIOPT Version :9

Sequence 1:NP_001285188.1 Gene:MFS10 / 32263 FlyBaseID:FBgn0030452 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_011579.1 Gene:VHT1 / 852956 SGDID:S000003297 Length:593 Species:Saccharomyces cerevisiae


Alignment Length:279 Identity:58/279 - (20%)
Similarity:93/279 - (33%) Gaps:94/279 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 ILEGMGEGVTYPAMHAMLAHWIPPLERNKFAAIVYAGSNIGTVISMPLAGWLCSLDF-------- 259
            ||...| ...||....:|..|..|.|.|....:.:.|..:|:|.|    |.|.|..|        
Yeast   226 ILSAFG-AAYYPVSQYILGCWYAPDEINSRVCLFFCGQQLGSVTS----GLLQSRIFKSLNGVHG 285

  Fly   260 LGGWPSAFYIFGL-LGILWFIAWMYLVYDKPSDHPRISESEREYIERSLQVQRLINQDLAEAEEE 323
            |.||...|.|..: :.:...|...:::...||....:..::.|     :::.|..|:   ..:.:
Yeast   286 LAGWRWMFLIDAIAISLPTAIIGFFVIPGVPSKCYSLFLTDEE-----IRIARARNK---RNQIK 342

  Fly   324 EGQDEVSLRAPPEEPIPWSSLLTSVPLWAILLTQCGQGWAFYTQLTELPTYMSNILHFDIQSNAL 388
            :|.|:..| ||......|..:..:...|.:::                         ||      
Yeast   343 DGVDKSKL-APLWSRKLWKKVFCTPAFWVLVV-------------------------FD------ 375

  Fly   389 LNAVPYLTSWFVGIACSALADWMLARRYISLLNSYKLW---NT---VA-----SVVPS-LGLIGI 441
                          .||    |.....|   ..||.||   ||   :|     ||:|: ||...:
Yeast   376 --------------TCS----WNNMTAY---SGSYTLWLKSNTKYSIAQVNNLSVIPACLGFAYV 419

  Fly   442 IYVG-------CDWVWVTF 453
            |:..       |.|:::.|
Yeast   420 IFCAFGADLFRCKWIFMVF 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS10NP_001285188.1 2A0114euk 63..547 CDD:129972 58/279 (21%)
MFS 134..538 CDD:119392 58/279 (21%)
VHT1NP_011579.1 MFS_FEN2_like 124..542 CDD:340885 58/279 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.