DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS10 and Slc17a7

DIOPT Version :10

Sequence 1:NP_572857.1 Gene:MFS10 / 32263 FlyBaseID:FBgn0030452 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_892038.2 Gene:Slc17a7 / 72961 MGIID:1920211 Length:560 Species:Mus musculus


Alignment Length:152 Identity:30/152 - (19%)
Similarity:54/152 - (35%) Gaps:30/152 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NAQQCSTPQTLYTCYISYLGKYGVVPDDGYLPPSEFILNQMMTHGLPVICKDFEELVSCL----- 75
            |.|....||::.|   |...:...:..|...|..  |:|:            |:|..:.|     
Mouse    97 NEQNPEDPQSINT---SGSDELEPIQSDWQRPRG--IINR------------FQEFKTRLLYANR 144

  Fly    76 --GTASTYCVNLNVFVAYTTGRHPDREALAYLQNHAFF----EFACGSGRDLFMNNLDCIQRSFQ 134
              .:.|.:....|....||......|:.||.|..:..|    :...|:.||  ..|::.:.::..
Mouse   145 DDASISIHFYKQNTLSIYTPVSRTQRKGLALLITNILFANKQDDRAGAERD--EENMEWLLKNLN 207

  Fly   135 QIPLTNRMQQCGQSSLAINEDS 156
            .:.:..|.....:.|.|:.:.|
Mouse   208 FMVIKYRNLTGNEISRAVQDFS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS10NP_572857.1 MFS_SLC17 73..538 CDD:340876 18/95 (19%)
Slc17a7NP_892038.2 MFS_SLC17A6_7_8_VGluT 66..490 CDD:340940 30/152 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 497..560
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.