DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS10 and SLC17A9

DIOPT Version :9

Sequence 1:NP_001285188.1 Gene:MFS10 / 32263 FlyBaseID:FBgn0030452 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_071365.4 Gene:SLC17A9 / 63910 HGNCID:16192 Length:436 Species:Homo sapiens


Alignment Length:492 Identity:128/492 - (26%)
Similarity:213/492 - (43%) Gaps:111/492 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LGFAVVYAMRVNLSVAIVAMVNQTAIPHSNSSVIDTDTCPLPAPHHNGSDPNPQKEGEFVWDEAT 141
            ||..::|..|.::.:..|:|                                   ..:|.|::..
Human    32 LGTCLLYCARSSMPICTVSM-----------------------------------SQDFGWNKKE 61

  Fly   142 QGLVLGSFFYGYVLTQVPGGRMAELYGGKKIYGYGVLITA----VFTLITPLAAHWD---LPLLV 199
            .|:||.|||:||.||||.||.:.:..||:|:    :|::|    ..|.:|||.||..   |..:.
Human    62 AGIVLSSFFWGYCLTQVVGGHLGDRIGGEKV----ILLSASAWGSITAVTPLLAHLSSAHLAFMT 122

  Fly   200 LVRILEGMGEGVTYPAMHAMLAHWIPPLERNKFAAIVYAGSNIGTVISMPLAGWLCSLDFLGGWP 264
            ..|||.|:.:||.:||:.::|:..:...||....:||.|||..||:::..:...|  |::. ||.
Human   123 FSRILMGLLQGVYFPALTSLLSQKVRESERAFTYSIVGAGSQFGTLLTGAVGSLL--LEWY-GWQ 184

  Fly   265 SAFYIFGLLGILWFIAWMYLVYDKPSDHPRISESEREYIERSLQVQRLINQDLAEAEEEEGQDEV 329
            |.||..|.|.:|    |::.||       |...||::.| .:|.|       ||::......:.|
Human   185 SIFYFSGGLTLL----WVWYVY-------RYLLSEKDLI-LALGV-------LAQSRPVSRHNRV 230

  Fly   330 SLRAPPEEPIPWSSLLTSVPLWAILLTQCGQGWAFYTQLTELPTYMSNILHFDIQSNALLNAVPY 394
                      ||..|.....:||.:::|.....:|:..|:.|||:....  |......:.|.|| 
Human   231 ----------PWRRLFRKPAVWAAVVSQLSAACSFFILLSWLPTFFEET--FPDAKGWIFNVVP- 282

  Fly   395 LTSWFVGIACSA----LADWMLARRYISLLNSYKLWNTVASVVPSLGL---------IGIIYVGC 446
               |.|.|..|.    |:|.::.:.|.::        ||..::..:||         :|.....|
Human   283 ---WLVAIPASLFSGFLSDHLINQGYRAI--------TVRKLMQGMGLGLSSVFALCLGHTSSFC 336

  Fly   447 DWVWVTFMLAGVGSFGGAVYAGNQMNHIALSPRYAGTMYGITNSAANICGFLAPYVIGLIINHRE 511
            :.|.......|:.:|.   ::|..:|...|:|..||.::|:.|:|..:.|.:...:.|.::   |
Human   337 ESVVFASASIGLQTFN---HSGISVNIQDLAPSCAGFLFGVANTAGALAGVVGVCLGGYLM---E 395

  Fly   512 TLTQWHLVFWLAAGLNIAGNFIYLIFASAEEQSWSKT 548
            |...|..:|.|.|.::..|...:|:|..|:....|.|
Human   396 TTGSWTCLFNLVAIISNLGLCTFLVFGQAQRVDLSST 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS10NP_001285188.1 2A0114euk 63..547 CDD:129972 126/489 (26%)
MFS 134..538 CDD:119392 118/423 (28%)
SLC17A9NP_071365.4 MFS_1 44..386 CDD:311564 111/429 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.