DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS10 and Slc17a9

DIOPT Version :9

Sequence 1:NP_001285188.1 Gene:MFS10 / 32263 FlyBaseID:FBgn0030452 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_038961483.1 Gene:Slc17a9 / 362287 RGDID:1311940 Length:448 Species:Rattus norvegicus


Alignment Length:372 Identity:101/372 - (27%)
Similarity:161/372 - (43%) Gaps:85/372 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SGAAEENHGCGPKTRHIFGFMGFLGFAVVYAMRVNLSVAIVAMVNQTAIPHSNSSVIDTDTCPLP 118
            |.|||:.....|:.:...|.: .||..::|..||.:.|..|||                      
  Rat    21 SAAAEDKRWSRPECQLWTGML-LLGTCLLYCTRVTMPVCTVAM---------------------- 62

  Fly   119 APHHNGSDPNPQKEGEFVWDEATQGLVLGSFFYGYVLTQVPGGRMAELYGGKKIYGYGVLITA-- 181
                         ..:|.|::...|:||.|||:||.||||.||.:.:..||:|:    :|::|  
  Rat    63 -------------SQDFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKV----ILLSASA 110

  Fly   182 --VFTLITPLAAH---WDLPLLVLVRILEGMGEGVTYPAMHAMLAHWIPPLERNKFAAIVYAGSN 241
              ..|:.|||.||   ..|..:...|||.|:.:||.:||:.::|:..:...||:...:.|.|||.
  Rat   111 WGFITVTTPLLAHLGSGHLAFVTFSRILTGLLQGVYFPALTSLLSQRVQESERSFTYSTVGAGSQ 175

  Fly   242 IGTVISMPLAGWLCSLDFLGGWPSAFYIFGLLGILWFIAWMYLVYDKPSDHPRISESEREYIERS 306
            :||:::..:...|  ||.. ||.|.||..|.|.:|    |:|.||              :|:   
  Rat   176 VGTLVTGGIGSVL--LDRC-GWQSVFYFSGGLTLL----WVYYVY--------------KYL--- 216

  Fly   307 LQVQRLINQDLAEAEEEEGQDEVSLRAPPEEP--IPWSSLLTSVPLWAILLTQCGQGWAFYTQLT 369
                 |..:||..|.....|.     .|...|  :||..|.....:||::.:|.....:|:..|:
  Rat   217 -----LDEKDLVLALGVLAQG-----LPVTRPSKVPWRQLFRKASVWAVICSQLSSACSFFILLS 271

  Fly   370 ELPTYMSNILHFDIQSNALLNAVPYLTSWFVGIACSALADWMLARRY 416
            .|||:....  |......:.|.||:|.:....:....::|.::::.|
  Rat   272 WLPTFFKET--FPHSKGWVFNVVPWLLAIPASLFSGFISDRLISQGY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS10NP_001285188.1 2A0114euk 63..547 CDD:129972 97/363 (27%)
MFS 134..538 CDD:119392 86/292 (29%)
Slc17a9XP_038961483.1 MFS 38..>326 CDD:421695 96/355 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.