powered by:
Protein Alignment MFS10 and C25H3.15
DIOPT Version :9
Sequence 1: | NP_001285188.1 |
Gene: | MFS10 / 32263 |
FlyBaseID: | FBgn0030452 |
Length: | 559 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001021983.1 |
Gene: | C25H3.15 / 3565066 |
WormBaseID: | WBGene00044391 |
Length: | 159 |
Species: | Caenorhabditis elegans |
Alignment Length: | 51 |
Identity: | 12/51 - (23%) |
Similarity: | 18/51 - (35%) |
Gaps: | 13/51 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 WTDESRDASCY-YD----------PSTSSNSSASAERSDDEADDEREAFCS 45
||| |:.||. || |......:.......||...:.:.:|:
Worm 31 WTD--REISCVTYDVNRTRCVLNHPQLGPEQNPECFDEVDENGKKLKTYCA 79
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
MFS10 | NP_001285188.1 |
2A0114euk |
63..547 |
CDD:129972 |
|
MFS |
134..538 |
CDD:119392 |
|
C25H3.15 | NP_001021983.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2532 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.