DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS10 and MFS18

DIOPT Version :9

Sequence 1:NP_001285188.1 Gene:MFS10 / 32263 FlyBaseID:FBgn0030452 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster


Alignment Length:473 Identity:129/473 - (27%)
Similarity:218/473 - (46%) Gaps:86/473 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VAIVAMVNQTAIPHSNSSVIDTDTCPLPAPHHNGSDPNPQKEGEFVWDEATQGLVLGSFFYGYVL 155
            |..:.::..|.:.:|..:     |.||..|    :..:.||     |.:...|.||.|||:||.|
  Fly    28 VWFITLITGTCMLYSTRT-----TMPLLVP----AVASAQK-----WSKTDSGTVLSSFFWGYTL 78

  Fly   156 TQVPGGRMAELYGGKKIYGYGVLITAVFTLITPLAAHWD--------LPLLVLVRILEGMGEGVT 212
            |||.||..::.:||:::..:..:..::.|.:.|... |.        :|.:|.:|||.|..:||.
  Fly    79 TQVVGGYFSDRFGGQRVILFAAIGWSLITFLMPTII-WTAGSIKSYAIPFIVAIRILNGALQGVH 142

  Fly   213 YPAMHAMLAHWIPPLERNKFAAIVYAGSNIGTVISMPLAGWLCSLDFLGGWPSAFYIFGLLGILW 277
            :|:|.::.:..:.|.||:.|..::.|||.:||:::..:..:|  ||:. ||...|.:.||:||.|
  Fly   143 FPSMISLTSQNLCPNERSSFFGLLTAGSALGTLLTGIMGSFL--LDYF-GWSYVFRVIGLMGIAW 204

  Fly   278 FIAWMYLVYDKPSDHPRISESEREYIERSLQVQRLINQDLAEAEEEEGQDEVSLRAPPEEPIPWS 342
            .:...|  |....:..||       |..:...:...|:..||.                ..:||.
  Fly   205 ALVLRY--YAMAGERNRI-------INIATPSRLCANKSPAET----------------SAVPWL 244

  Fly   343 SLLTSVPLWAILLTQCGQGWAFYTQLTELPTYMSNILHFDIQSNALLNAVPYLTSWFVGIACSAL 407
            .....:..||.:||...:...|:..|:.||||..:  .|......::|.:|:|          ||
  Fly   245 RYFRRLSFWACVLTHACEMNCFFVLLSWLPTYFHD--GFPHAKGWVVNMIPWL----------AL 297

  Fly   408 ADWMLARRYISLLNSYKLWN--TVASVVPS-------LGLIGIIYVGCDW----VWVTFMLAGVG 459
            ....|..:|::.....:.|:  ||..|:.|       |.|. ::....|:    :.:|.::.|.|
  Fly   298 PPCTLFAKYLTTRLLAREWHTTTVRKVIQSCCFAAQNLALF-VMSRTSDFHTALICMTIIIGGTG 361

  Fly   460 SFGGAVYAGNQMNHIALSPRYAGTMYGITNSAANICGFLAPYVIGLIINHRETLTQ-WHLVFWLA 523
            ....||    .:|...|:|.::|:::|:.|:...|.|||..|:.|.|:.    ||| |.:||..|
  Fly   362 FHNNAV----TVNPQDLAPLHSGSVFGLMNTVGAIPGFLGVYLAGHILE----LTQSWPMVFSAA 418

  Fly   524 AGLNIAGNFIYLIFASAE 541
            ||:|:.|..|:::|.|||
  Fly   419 AGINLVGWIIFIVFGSAE 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS10NP_001285188.1 2A0114euk 63..547 CDD:129972 129/473 (27%)
MFS 134..538 CDD:119392 116/425 (27%)
MFS18NP_608835.1 MFS 30..432 CDD:119392 124/465 (27%)
MFS_1 32..397 CDD:284993 108/424 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.