DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS10 and F41C3.2

DIOPT Version :9

Sequence 1:NP_001285188.1 Gene:MFS10 / 32263 FlyBaseID:FBgn0030452 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_494849.2 Gene:F41C3.2 / 173821 WormBaseID:WBGene00018268 Length:499 Species:Caenorhabditis elegans


Alignment Length:496 Identity:100/496 - (20%)
Similarity:182/496 - (36%) Gaps:123/496 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 NQTAIPHS---NSSVIDTD-------TCPLPAPHHNGSDPNPQKEGEFVWDEATQGLVLGSFFYG 152
            |:|.:|.|   |.|..:.|       ..|||                             |....
 Worm    77 NETILPSSLNFNFSKFEQDLLFSAAYIAPLP-----------------------------SIIIL 112

  Fly   153 YVLTQVPGGRMAELYGGKKIYGYGVLITAVFTLITPLAAHWDLPLLVLVRILEGMGEGVTYPAMH 217
            |.||...|.:...|...        :::.:.|::||:|..:........|..:|:...:....:.
 Worm   113 YFLTNRSGVKTTFLICS--------MLSFLSTILTPIATQYGFWFFWAARFFQGLPTAILGIVVS 169

  Fly   218 AMLAHWIPPLERNKFAAIVYAGSNIGTVISMPLAGWLCSLDFLGGWPSAFYIFGLLGILWFIAWM 282
            .:..||....|...:.:|:.|...|..:::|||:..:||   :|||.|.:|..|.:..:..:.:.
 Worm   170 VVTCHWSTLTENGTYVSILAAHYQIAPLLTMPLSALMCS---VGGWSSVYYTQGTITAILIVLFA 231

  Fly   283 YLVYDKPSDHPRISESEREYIERSLQVQRLINQDLAEAEEEEGQDEVSLRAPPEEPIPWSSLLTS 347
            ....||||:...:|:.|.:.||.        .:.|.|...|:.:            .|:.::...
 Worm   232 VFYTDKPSESKFVSKGELKAIED--------GKSLEEKHVEKSK------------TPFVAIHKD 276

  Fly   348 VPLWAILLTQCGQGWAFYTQLTELPTYMSNILHFDIQSNALLNAVPYLTSWFVGIA-------CS 405
            ..:|||.:|..|....|...|...|||::.:||:::.:.....||||:.|....|.       ||
 Worm   277 PAVWAIWITSVGGTIGFSIFLQYGPTYLNKVLHYNLSTTGWTAAVPYIFSCIARIVAQPLSANCS 341

  Fly   406 ALADWMLARRYISLLNSYKLWNTVASVVPSLGLIGIIYVGCDWVWVTFMLAGVGSFGGAVYAGNQ 470
            .|.:.:.|               :.:...|.|.:.|.::...::..|:...|...: ..|...|.
 Worm   342 FLGERLAA---------------IVTTTISQGTMAICFLVLMFIPQTWSSVGQLCY-SLVIVANG 390

  Fly   471 MNHIALSPRYAGTMYGITNSAANIC------------------GFLAPYVIGLIINHRETLTQWH 517
            :|.:           |||.||..:|                  |...|.::..:..: :|..:|.
 Worm   391 LNGV-----------GITRSAQLVCKQHMSFVYTARAFYNGSVGLFLPLLVNFVAPN-DTHNEWT 443

  Fly   518 LVFWLAAGLNIAGNFIYLIFASAEEQSWSKTPPTRNSRSQR 558
            .:|.:...:....|.|::.|:|.|...|:......::||::
 Worm   444 RLFLIIFCIVFVSNLIFIAFSSTEPAQWTIGTSEVDNRSEQ 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS10NP_001285188.1 2A0114euk 63..547 CDD:129972 98/483 (20%)
MFS 134..538 CDD:119392 84/428 (20%)
F41C3.2NP_494849.2 2A0114euk 30..471 CDD:129972 97/481 (20%)
MFS 86..463 CDD:119392 90/464 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.