DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and ALDH1A2

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_003879.2 Gene:ALDH1A2 / 8854 HGNCID:15472 Length:518 Species:Homo sapiens


Alignment Length:227 Identity:45/227 - (19%)
Similarity:80/227 - (35%) Gaps:64/227 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LQPTAQETKLALIPSAPQWRSPQLMVVFEDGDLHSARHQLLQSLQNPFAEGSVAT----LLLQES 81
            :|..|..:.|..:......:||.  ::|.|.||..|..|..|.:.  |.:|...|    :.::||
Human   271 IQEAAGRSNLKRVTLELGGKSPN--IIFADADLDYAVEQAHQGVF--FNQGQCCTAGSRIFVEES 331

  Fly    82 IADQFV---------GLVAQDLRPLSQ---EVSKHPSYTSTLAKIEELKAKTVQGESLKAGESPV 134
            |.::||         .:|.....|.::   ::.| ..|...|   |.:::...:|..|:.|..  
Human   332 IYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDK-KQYNKIL---ELIQSGVAEGAKLECGGK-- 390

  Fly   135 LVYDCVHSYLGNGATG-------------------------VVTVHTFRTAKEAGQLAKRDPLPY 174
                      |.|..|                         |..:..|:|..|..:.|...  .:
Human   391 ----------GLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNS--DF 443

  Fly   175 GQV-SLWNEKLGCAYELIPRLPSDIVAINCFN 205
            |.| :::...:..|..:...:.:..|.|||:|
Human   444 GLVAAVFTNDINKALTVSSAMQAGTVWINCYN 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 42/210 (20%)
ALDH1A2NP_003879.2 ALDH_F1AB_F2_RALDH1 32..512 CDD:143459 45/227 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.