DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and PUT2

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_011902.1 Gene:PUT2 / 856432 SGDID:S000001079 Length:575 Species:Saccharomyces cerevisiae


Alignment Length:224 Identity:39/224 - (17%)
Similarity:75/224 - (33%) Gaps:86/224 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SQPSRITSYMVNQLQPTAQETK--LALIPSAPQWRSPQLMVVFEDGDLH---------------- 54
            ||.:.:::|::..:...|...|  :..||..|...:.|::...:.|.||                
Yeast   236 SQTAALSNYLLMTVLEEAGLPKGVINFIPGDPVQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQ 300

  Fly    55 ------------------------------SARHQLLQSLQNPFA-EG----SVATLLLQESIAD 84
                                          :..|.:|.:::..|. :|    :.:.|.|.||.::
Yeast   301 SGVVEGKYRDYPRIIGETGGKNFHLVHPSANISHAVLSTIRGTFEFQGQKCSAASRLYLPESKSE 365

  Fly    85 QFVGLVAQDLRPLSQEVSKHPSYTSTLAKIEELKAKTVQGESLKAGESPVLVYDCVHSYLGNGAT 149
            :|:    .|:..:.|..:..|..||         |..:.|.:|:....||     :|.       
Yeast   366 EFL----SDMFGILQSQNVVPMNTS---------ASPISGGNLRGFMGPV-----IHE------- 405

  Fly   150 GVVTVHTFRTAKEAGQLAKRDP---LPYG 175
                 .:|....:..:.||:||   :.||
Yeast   406 -----QSFDKLVKVIEDAKKDPELEILYG 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 31/192 (16%)
PUT2NP_011902.1 D1pyr5carbox1 29..574 CDD:273517 39/224 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.