DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and HFD1

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_013828.1 Gene:HFD1 / 855137 SGDID:S000004716 Length:532 Species:Saccharomyces cerevisiae


Alignment Length:130 Identity:24/130 - (18%)
Similarity:52/130 - (40%) Gaps:24/130 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LLLQESIADQFVGLVAQDL-RPLSQEVSKHPS------YTSTLAKIEELKAKTVQGESLKAGESP 133
            |:.||:.|.....:..:|| ..:::.:.:|.:      ::.:..:|..:..:...|:.: .|::.
Yeast   365 LMKQENFAPVLPIIEYEDLDETINKIIEEHDTPLVQYIFSDSQTEINRILTRLRSGDCV-VGDTV 428

  Fly   134 VLVYDCVHSYLGNGATGVVT---VHTFRTAKEAGQLAKRDPLPYGQVSLWNEKLGCAYELIPRLP 195
            :.|......:.|.|.:|...   .:.|.|......:.|:   ||     ||:     :.|..|.|
Yeast   429 IHVGITDAPFGGIGTSGYGNYGGYYGFNTFSHERTIFKQ---PY-----WND-----FTLFMRYP 480

  Fly   196  195
            Yeast   481  480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 24/130 (18%)
HFD1NP_013828.1 ALDH-SF 11..466 CDD:416387 16/101 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.