Sequence 1: | NP_001285186.1 | Gene: | CG15717 / 32262 | FlyBaseID: | FBgn0030451 | Length: | 252 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_009560.1 | Gene: | UGA2 / 852291 | SGDID: | S000000210 | Length: | 497 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 235 | Identity: | 47/235 - (20%) |
---|---|---|---|
Similarity: | 78/235 - (33%) | Gaps: | 71/235 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 FTQSQPSRITSYMVNQLQPTAQETKLALIPSAPQWRSPQLMVVFEDGDLHSARHQLLQSLQNPFA 69
Fly 70 EGSVAT--LLLQESIADQFVGLVAQDLRPLSQEVSKHPSYT-------STLAKIEELK------- 118
Fly 119 AKTV--QGESLKAGES--------------------------PVLVYDCVHSYLGNG-------- 147
Fly 148 ----ATGVVTVHTFRTAKEAGQLAKRD------PLPYGQV 177 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15717 | NP_001285186.1 | DUF1487 | 38..250 | CDD:254173 | 39/202 (19%) |
UGA2 | NP_009560.1 | SSADH | 37..486 | CDD:188167 | 47/235 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1012 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |