DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and UGA2

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_009560.1 Gene:UGA2 / 852291 SGDID:S000000210 Length:497 Species:Saccharomyces cerevisiae


Alignment Length:235 Identity:47/235 - (20%)
Similarity:78/235 - (33%) Gaps:71/235 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FTQSQPSRITSYMVNQLQPTAQETKLALIPSAPQWRSPQLMVVFEDGDLHSARHQLLQSLQNPFA 69
            ||.|  :.:...::.|...|.::....|..:||       .:||||.||..|..|.:........
Yeast   240 FTGS--TNVGKILMKQSSSTLKKLSFELGGNAP-------FIVFEDADLDQALEQAMACKFRGLG 295

  Fly    70 EGSVAT--LLLQESIADQFVGLVAQDLRPLSQEVSKHPSYT-------STLAKIEELK------- 118
            :..|..  |.:..||.|:|..|:|:.::.........|..|       |.:.|:|..|       
Yeast   296 QTCVCANRLYVHSSIIDKFAKLLAERVKKFVIGHGLDPKTTHGCVINSSAIEKVERHKQDAIDKG 360

  Fly   119 AKTV--QGESLKAGES--------------------------PVLVYDCVHSYLGNG-------- 147
            ||.|  .|...:.|.:                          |:..:|.:...:|..        
Yeast   361 AKVVLEGGRLTELGPNFYAPVILSHVPSTAIVSKEETFGPLCPIFSFDTMEEVVGYANDTEFGLA 425

  Fly   148 ----ATGVVTVHTFRTAKEAGQLAKRD------PLPYGQV 177
                :..|.|::|...|.|.|.::...      .:|:|.|
Yeast   426 AYVFSKNVNTLYTVSEALETGMVSCNTGVFSDCSIPFGGV 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 39/202 (19%)
UGA2NP_009560.1 SSADH 37..486 CDD:188167 47/235 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.