DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and aldh16a1

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001039089.1 Gene:aldh16a1 / 733905 XenbaseID:XB-GENE-5726619 Length:829 Species:Xenopus tropicalis


Alignment Length:203 Identity:58/203 - (28%)
Similarity:86/203 - (42%) Gaps:54/203 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RSPQLMVVFEDGDLHSARHQLLQSLQNPFAEGSVAT----LLLQESIADQFVGLVAQDLRPLSQE 100
            :||  .:||:..||.||...::.::.  |.:|.|.:    ||:|||||:..:       |.|.|.
 Frog   279 KSP--FIVFDTSDLDSAVEGIVDAIW--FNQGQVCSAGSRLLMQESIAEDLI-------RRLKQR 332

  Fly   101 VSKHPSYTSTLAK-------IEELKAKTV-------QGESLKAGESP------VLVYD------- 138
            :| |.....:|.|       ::|.:.||:       |.|.....:||      .|.|.       
 Frog   333 MS-HLRLGDSLDKAIDVGALVDETQKKTIEEFVEEAQAEGADVFQSPGPIPKKGLFYPPTLITGV 396

  Fly   139 -----CVHSYLGNGATGVVTVHTFRTAKEAGQLAKRDPLPYG-QVSLWNEKLGCAYELIPRLPSD 197
                 ||...:..   .|:...||||||||  :|..:..||| ..|:|.|.|..|.|:...:.:.
 Frog   397 NTTSRCVREEIFG---PVLVAMTFRTAKEA--IALGNNTPYGLAASVWTENLPLALEVAISIKAG 456

  Fly   198 IVAINCFN 205
            .|.:|..|
 Frog   457 TVWVNGHN 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 58/203 (29%)
aldh16a1NP_001039089.1 ALDH_F16 21..500 CDD:143429 58/203 (29%)
ALDH-SF 572..>788 CDD:299846
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.