DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and Aldh1b1

DIOPT Version :10

Sequence 1:NP_572856.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_082546.1 Gene:Aldh1b1 / 72535 MGIID:1919785 Length:519 Species:Mus musculus


Alignment Length:73 Identity:16/73 - (21%)
Similarity:28/73 - (38%) Gaps:13/73 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LQPTAQETKLALIPSAPQWRSPQLMVVFEDGDLHSARHQLLQSL-----------QNPFAEGSVA 74
            :|..|.|:.|..:......:||.  :|..|.|:..|..|..::|           ...|.|.|:.
Mouse   272 IQKAAGESNLKRVTLELGGKSPS--IVLADADMEHAVDQCHEALFFNMGQCCCAGSRTFVEESIY 334

  Fly    75 TLLLQESI 82
            ...|:.::
Mouse   335 REFLERTV 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_572856.1 DUF1487 38..250 CDD:254173 12/56 (21%)
Aldh1b1NP_082546.1 ALDH_F1AB_F2_RALDH1 33..513 CDD:143459 16/73 (22%)

Return to query results.
Submit another query.