powered by:
Protein Alignment CG15717 and Aldh1b1
DIOPT Version :9
Sequence 1: | NP_001285186.1 |
Gene: | CG15717 / 32262 |
FlyBaseID: | FBgn0030451 |
Length: | 252 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_082546.1 |
Gene: | Aldh1b1 / 72535 |
MGIID: | 1919785 |
Length: | 519 |
Species: | Mus musculus |
Alignment Length: | 73 |
Identity: | 16/73 - (21%) |
Similarity: | 28/73 - (38%) |
Gaps: | 13/73 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 LQPTAQETKLALIPSAPQWRSPQLMVVFEDGDLHSARHQLLQSL-----------QNPFAEGSVA 74
:|..|.|:.|..:......:||. :|..|.|:..|..|..::| ...|.|.|:.
Mouse 272 IQKAAGESNLKRVTLELGGKSPS--IVLADADMEHAVDQCHEALFFNMGQCCCAGSRTFVEESIY 334
Fly 75 TLLLQESI 82
...|:.::
Mouse 335 REFLERTV 342
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1012 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.