DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and Aldh1l1

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_071992.2 Gene:Aldh1l1 / 64392 RGDID:621294 Length:902 Species:Rattus norvegicus


Alignment Length:193 Identity:44/193 - (22%)
Similarity:86/193 - (44%) Gaps:32/193 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RSPQLMVVFEDGDLHSARHQLLQSL-----QNPFAEGSVATLLLQESIADQFVGLVAQDL----- 94
            :||  :::|.|.||:.|....:.|:     :|..|.|   .|.::|||.:|||..|.:::     
  Rat   677 KSP--LIIFADCDLNKAVQMGMSSVFFNKGENCIAAG---RLFVEESIHNQFVQKVVEEVEKMKI 736

  Fly    95 -RPLSQEVSKHP-SYTSTLAKIEELKAKTV-QGESLKAGESPV---------LVYDCV--HSYLG 145
             .||.::.:..| ::.:.|.|:.|...:.| :|.:|..|.:.|         .|:..|  |.|:.
  Rat   737 GNPLERDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQVPRPGFFFQPTVFTDVEDHMYIA 801

  Fly   146 NGAT--GVVTVHTFRTAKEAGQLAKRDPLPYGQVS-LWNEKLGCAYELIPRLPSDIVAINCFN 205
            ...:  .::.:..|........|::.:...:|..| ::...:..|..:..:|.:..|.||.:|
  Rat   802 KEESFGPIMIISRFADGDVDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFINTYN 864

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 44/193 (23%)
Aldh1l1NP_071992.2 GART 1..203
Substrate binding. /evidence=ECO:0000250 88..90
Aldehyde dehydrogenase 417..902 44/193 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.