DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and Aldh3b2

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001170909.1 Gene:Aldh3b2 / 621603 MGIID:2147613 Length:479 Species:Mus musculus


Alignment Length:216 Identity:40/216 - (18%)
Similarity:62/216 - (28%) Gaps:73/216 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASNFTQSQPSRITSYMVNQLQPTAQETKLALIPSAPQWRSPQLMVVFEDGDLHSARHQLLQSLQN 66
            |.|....:||.|           ::.|:..|....||:.......|...|. ...|..|......
Mouse   144 AGNCVVLKPSEI-----------SKNTEKVLAELLPQYLDQSCFAVMLGGP-EETRQLLEHKFDY 196

  Fly    67 PFAEGS--VATLLLQESIADQFVGLVAQDLRPLSQEV-SKHPSYTSTLAKIEELKAKTVQGESLK 128
            .|..||  |..:::..:         |:.|.|::.|: .|:|.|..     :....:||      
Mouse   197 IFFTGSPRVGKIVMTAA---------AKHLTPITLELGGKNPCYVD-----DNCDPQTV------ 241

  Fly   129 AGESPVLVYDCVHSYLGNGATGVVTVHTFRTAKEAGQLAKRDPLPYGQVSLWNEKLGCAYE---- 189
                               |..|.....|..               ||..:..:.:.|:.|    
Mouse   242 -------------------ANRVAWFRYFNA---------------GQTCVAPDYILCSQEMQER 272

  Fly   190 LIPRLPSDIVAINCFNPDLDP 210
            |:|.|.:.|......||...|
Mouse   273 LVPALQNSITRFYGDNPQTSP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 32/180 (18%)
Aldh3b2NP_001170909.1 ALDH_F3AB 18..459 CDD:143450 40/216 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.