DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and Aldh1a3

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_444310.3 Gene:Aldh1a3 / 56847 MGIID:1861722 Length:512 Species:Mus musculus


Alignment Length:202 Identity:45/202 - (22%)
Similarity:72/202 - (35%) Gaps:62/202 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VVFEDGDLHSA---RHQLLQSLQNPFAEGSVAT----LLLQESIADQFVGLVAQDLRPLSQEVSK 103
            :|..|.||..|   .||.:.     |.:|...|    :.::|.:..:||       |...:...|
Mouse   288 IVCADADLDLAVECAHQGVF-----FNQGQCCTAASRVFVEEQVYGEFV-------RRSVEFAKK 340

  Fly   104 HPSYTSTLAKIEELKAKTVQG------------ESLKAGESPVLVYDCVHSYLGNGATGV----- 151
            .|..       :...|||.||            |.:::|:......:|..|.:.:....:     
Mouse   341 RPVG-------DPFDAKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDRGLFIKPTVF 398

  Fly   152 --VTVHTFRTAKE--------------AGQLAKR-DPLPYG-QVSLWNEKLGCAYELIPRLPSDI 198
              || ...|.|||              ..::.|| :...|| ..:::.:.|..|.:|...|.|..
Mouse   399 SDVT-DNMRIAKEEIFGPVQPILKFKNLEEVIKRANSTDYGLTAAVFTKNLDKALKLAAALESGT 462

  Fly   199 VAINCFN 205
            |.|||:|
Mouse   463 VWINCYN 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 45/202 (22%)
Aldh1a3NP_444310.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
ALDH_F1AB_F2_RALDH1 26..506 CDD:143459 45/202 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.