DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and CG12516

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_651615.2 Gene:CG12516 / 43370 FlyBaseID:FBgn0039577 Length:300 Species:Drosophila melanogaster


Alignment Length:235 Identity:97/235 - (41%)
Similarity:153/235 - (65%) Gaps:11/235 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QPTAQETKLALIPSAPQWRSPQLMVVFEDGDLHSARHQLLQSLQNPFAEGSVATLLLQESIADQF 86
            :|..:|.|.|       |.:|.:||:|||||::.|.|.|::|||:|||..:||.:|:||::|::.
  Fly    73 EPKEEEVKYA-------WNAPCMMVIFEDGDVNCALHHLVESLQDPFALDAVAVILVQEALAEEI 130

  Fly    87 VGLVAQDLRPLSQEVSKHPSYTSTLAKIEELKAKTVQGES--LKAGESPVLVYDCVHSYLGNGAT 149
            ...|...::||...|:.||.|..||.||:||:.||:.|.|  :....:|::|.|..|.:||:|.|
  Fly   131 ENRVKILMKPLDARVANHPCYKRTLMKIDELRPKTIIGPSDRVLPDATPIMVRDIPHKFLGDGPT 195

  Fly   150 GVVTVHTFRTAKEAGQLAKRD-PLPYGQVSLWNEKLGCAYELIPRLP-SDIVAINCFNPDLDPIW 212
            |::|:|.|||..||.|:.::: |||...||:|||::...|::|..:. .|...||||..|::||.
  Fly   196 GIITMHIFRTPFEATQIYRKEYPLPIASVSIWNERVSSVYDVIGMMNLLDTFKINCFTVDMEPIK 260

  Fly   213 ESFAADRNDVLLAKNYHYESLVVSGKRRIVVFPVGTIFGN 252
            .:|...:....:.:.||||:|.::|:|:|:::||||||||
  Fly   261 RAFELRKYSACIHRGYHYETLPINGERKIIIYPVGTIFGN 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 89/215 (41%)
CG12516NP_651615.2 DUF1487 82..298 CDD:254173 90/222 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457898
Domainoid 1 1.000 69 1.000 Domainoid score I16590
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007614
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.