DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and CG2336

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster


Alignment Length:245 Identity:111/245 - (45%)
Similarity:153/245 - (62%) Gaps:10/245 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SQPSRITSYMVNQLQPTAQETKLALIPSAPQWRSPQLMVVFEDGDLHSARHQLLQSLQNPFAEGS 72
            |..||.:|...::.:|..|...        ||.||:||::.||||::.|.|.|::||.:|||..:
  Fly    75 SYHSRSSSMSEDEPEPEVQVKY--------QWNSPRLMILCEDGDINCALHYLVESLHDPFACNA 131

  Fly    73 VATLLLQESIADQFVGLVAQDLRPLSQEVSKHPSYTSTLAKIEELKAKTVQG--ESLKAGESPVL 135
            ||||.|||||.::||..:...|.|||.::|.||.|..||.:|..|:||.:.|  :::....||:|
  Fly   132 VATLFLQESILEEFVDRIRDRLEPLSTDISGHPVYIMTLERIGHLQAKRIVGNPKTVPENASPML 196

  Fly   136 VYDCVHSYLGNGATGVVTVHTFRTAKEAGQLAKRDPLPYGQVSLWNEKLGCAYELIPRLPSDIVA 200
            |||..|.||.:|.|||:|:|||||.|||.:|..::||.:..|.:|||||..||||:.||...|..
  Fly   197 VYDLSHRYLADGPTGVITLHTFRTMKEAVELQAKEPLNFTSVCIWNEKLAAAYELVARLSPLIFT 261

  Fly   201 INCFNPDLDPIWESFAADRNDVLLAKNYHYESLVVSGKRRIVVFPVGTIF 250
            |||:..:|:.|...|..:.|...:...||||||...|||::||.|||||:
  Fly   262 INCYYVNLNEITLPFVCNFNSAKIIDGYHYESLTFKGKRKVVVHPVGTIW 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 104/213 (49%)
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 104/213 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457908
Domainoid 1 1.000 69 1.000 Domainoid score I16590
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007614
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.