DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and aldh2.1

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_956784.1 Gene:aldh2.1 / 393462 ZFINID:ZDB-GENE-040426-1262 Length:516 Species:Danio rerio


Alignment Length:199 Identity:38/199 - (19%)
Similarity:75/199 - (37%) Gaps:46/199 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RSPQLMVVFEDGDLHSARHQLLQSLQNPFAEGSV----ATLLLQESIADQFVGLVAQDLR----- 95
            :||.  ::..|.::..|..|...:|.  |.:|..    ....:||||.|:||....:..:     
Zfish   288 KSPN--IILSDANMEEAVEQAHSALF--FNQGQCCCAGTRTFVQESIYDEFVERSVERAKNRIVG 348

  Fly    96 -PLSQEVSKHPSYTSTLAKIEELKAKTV---------QGESLKAGESPV-----LVYDCVHSYLG 145
             |......:.|       :::|.:.|.|         :|..|..|.:|.     .:...|...:.
Zfish   349 DPFDLNTEQGP-------QVDEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTVFGDVK 406

  Fly   146 NGAT--------GVVTVHTFRTAKEAGQLAKRDPLPYG-QVSLWNEKLGCAYELIPRLPSDIVAI 201
            :..|        .|:.:..|::.:|.  :.:.:...|| ..:::.:.:..|..:...|.:..|.|
Zfish   407 DDMTIAREEIFGPVMQILKFKSLEEV--IERANDSKYGLAAAVFTQNIDKANYISHGLRAGTVWI 469

  Fly   202 NCFN 205
            ||:|
Zfish   470 NCYN 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 38/199 (19%)
aldh2.1NP_956784.1 ALDH_F1AB_F2_RALDH1 30..510 CDD:143459 38/199 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.