DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and CG8665

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_610107.1 Gene:CG8665 / 35407 FlyBaseID:FBgn0032945 Length:913 Species:Drosophila melanogaster


Alignment Length:194 Identity:40/194 - (20%)
Similarity:80/194 - (41%) Gaps:33/194 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RSPQLMVVFEDGDLHSARHQLLQSL-----QNPFAEGSVATLLLQESIADQFVGLVAQDLR---- 95
            :||  :::|.|.|:..|....:.|:     :|..|.|   .|.:::.|.|:|:..|.:|||    
  Fly   687 KSP--LIIFADCDMDKAVKHGMSSVFFNKGENCIAAG---RLFVEDRIHDEFIRRVLKDLRTMTI 746

  Fly    96 --PLSQEVSKHP-SYTSTLAKIEELKAKTV-QGESLKAGE-----------SPVL---VYDCVHS 142
              ||.:..:..| ::.:...|:.|...:.| :|..|..|.           :|.:   |.|.:..
  Fly   747 GDPLDRSTAHGPQNHKAHFDKLLEFCRRGVDEGAKLVYGGCRVPNLKGYFFTPTVFTNVTDDMFI 811

  Fly   143 YLGNGATGVVTVHTFRTAKEAGQLAKRDPLPYGQVS-LWNEKLGCAYELIPRLPSDIVAINCFN 205
            ........::.:..|..:.....:.:.:...||..| ::.:.:|.|.....|:.:..|.:|.:|
  Fly   812 AQEESFGPIMIISKFNGSDIDSLMQRANRTEYGLASGVFTKDIGKALNFADRIEAGTVFVNVYN 875

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 40/194 (21%)
CG8665NP_610107.1 Fmt 4..315 CDD:223301
FMT_core 5..207 CDD:294280
FDH_Hydrolase_C 212..316 CDD:187731
PP-binding 338..403 CDD:278949
PLN02466 396..909 CDD:215259 40/194 (21%)
ALDH_F1L_FTFDH 428..913 CDD:143458 40/194 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.