DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and Aldh

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001260290.1 Gene:Aldh / 34256 FlyBaseID:FBgn0012036 Length:520 Species:Drosophila melanogaster


Alignment Length:209 Identity:40/209 - (19%)
Similarity:78/209 - (37%) Gaps:27/209 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LQPTAQETKLALIPSAPQWRSPQLMVVFEDGD--LHSARHQLLQSLQNPFAEGSVATLLLQESIA 83
            :|..:..|.|..:......:||.:::...|.|  :.:|...|..::......||  ...:::.|.
  Fly   272 IQLASGNTNLKRVTLELGGKSPNIILSDTDMDYAVETAHFGLFFNMGQCCCAGS--RTFVEDKIY 334

  Fly    84 DQFVGLVAQDLR------PLSQEVSKHPSYT-STLAKI-------EELKAKTVQGESLKAGESPV 134
            |:||...|:..:      |......:.|... ..:.||       ::..||.|.|.|...|....
  Fly   335 DEFVERSAERAKKRTVGNPFDLNTEQGPQVNEEQMEKILGMIKTGKKQGAKLVAGGSRPEGLPGY 399

  Fly   135 LVYDCVHSYLGNGATGVVTVHTFRTAKEAGQLAKRDPL-------PYG-QVSLWNEKLGCAYELI 191
            .|...|.:.:.:..| :.....|...::..:..|.|.:       .|| ..:::.:.|..|..::
  Fly   400 FVQPTVFADVQDDMT-IAREEIFGPVQQLIRFKKLDEVIERANNSEYGLAAAVFTKDLDKANYIV 463

  Fly   192 PRLPSDIVAINCFN 205
            ..|.:..|.:|.:|
  Fly   464 GGLRAGTVWVNTYN 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 37/192 (19%)
AldhNP_001260290.1 PLN02466 9..512 CDD:215259 40/209 (19%)
ALDH_F1AB_F2_RALDH1 34..514 CDD:143459 40/209 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.