DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and CG12637

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_572645.1 Gene:CG12637 / 31996 FlyBaseID:FBgn0030224 Length:292 Species:Drosophila melanogaster


Alignment Length:216 Identity:66/216 - (30%)
Similarity:112/216 - (51%) Gaps:9/216 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WRSPQLMVVFEDGDLHSARHQLLQSLQNPFAEGSVATLLLQESIADQFVGLVAQDLRPLSQEVSK 103
            |:.|.|:|:.::.|:..|...||.:|:.|||.|.|.::.:.|::.|.|..||...:..:..:.:.
  Fly    23 WKDPTLLVICQNADVAKAMQPLLHALKQPFAPGLVVSVFVHETMRDSFCDLVRNSMERMHHQAAT 87

  Fly   104 HPSYTSTLAKIEELKAKTV--------QGESLKAGESPVLVYDCVHSYLGNG-ATGVVTVHTFRT 159
            |.||...:..:..|:|:.|        :.:...:..|||:|.:..||:.|.. .:.|||:||||.
  Fly    88 HSSYVKAVEMLNCLQAEVVSMLTPDDIRFQFRMSDASPVIVCEFDHSFFGGSRPSSVVTLHTFRN 152

  Fly   160 AKEAGQLAKRDPLPYGQVSLWNEKLGCAYELIPRLPSDIVAINCFNPDLDPIWESFAADRNDVLL 224
            |.|..:|...:.:|:..|::|...:...||...:|...:|.|||....|.||.....|.:..|:|
  Fly   153 ATELPRLLATERVPFVSVAVWGSHMATVYEAALQLDISVVYINCHGISLTPIKSFLDAGKPHVVL 217

  Fly   225 AKNYHYESLVVSGKRRIVVFP 245
            |..:|:|.::..||.|.:|:|
  Fly   218 AHYHHFEVILHGGKLRAIVYP 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 66/216 (31%)
CG12637NP_572645.1 DUF1487 22..243 CDD:254173 66/216 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457896
Domainoid 1 1.000 69 1.000 Domainoid score I16590
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007614
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.