DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and CG31076

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_733184.2 Gene:CG31076 / 318582 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster


Alignment Length:204 Identity:41/204 - (20%)
Similarity:66/204 - (32%) Gaps:90/204 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LVAQDLRPLSQE-VSKHPSYT-------------STLAKIEELKAKTVQGESLKAGESPVLVYDC 139
            ||.|:||.|.|| |.||..:.             |.||..|:|:...:  :|.:..|:.:....|
  Fly    13 LVQQNLRTLPQELVKKHADHVEQLDLSHNCLKDLSWLADFEQLRHLVL--DSNRMHEAHLRTLTC 75

  Fly   140 VHSYLGNGATGVVTVHTFRTAKEAGQLAKRDPLPYGQVSLWNEKLGCAYELIPRLPSDIVAINCF 204
                                           |||..:|.:.|:      .....||:.:..|..|
  Fly    76 -------------------------------PLPQLEVLMLNK------NEFSDLPTTMRLIRKF 103

  Fly   205 NPDL-------DPI--------------------WESFAADR-------NDVLLAKNYHYESLVV 235
            .|:|       :||                    :.::.|..       :..|:.:.|.|||..:
  Fly   104 FPNLQYLSLHGNPICPDGLELQPFSTYLRYDYEYYSNYIAQSLSKLKFLDHGLVQRTYKYESFPI 168

  Fly   236 ---SGKRRI 241
               :||:.|
  Fly   169 KNYNGKQLI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 41/204 (20%)
CG31076NP_733184.2 LRR_8 11..65 CDD:290566 17/53 (32%)
leucine-rich repeat 11..32 CDD:275378 11/18 (61%)
leucine-rich repeat 33..54 CDD:275378 3/20 (15%)
leucine-rich repeat 55..79 CDD:275378 6/56 (11%)
leucine-rich repeat 80..106 CDD:275378 6/31 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.