Sequence 1: | NP_001285186.1 | Gene: | CG15717 / 32262 | FlyBaseID: | FBgn0030451 | Length: | 252 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_733184.2 | Gene: | CG31076 / 318582 | FlyBaseID: | FBgn0051076 | Length: | 182 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 41/204 - (20%) |
---|---|---|---|
Similarity: | 66/204 - (32%) | Gaps: | 90/204 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 LVAQDLRPLSQE-VSKHPSYT-------------STLAKIEELKAKTVQGESLKAGESPVLVYDC 139
Fly 140 VHSYLGNGATGVVTVHTFRTAKEAGQLAKRDPLPYGQVSLWNEKLGCAYELIPRLPSDIVAINCF 204
Fly 205 NPDL-------DPI--------------------WESFAADR-------NDVLLAKNYHYESLVV 235
Fly 236 ---SGKRRI 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15717 | NP_001285186.1 | DUF1487 | 38..250 | CDD:254173 | 41/204 (20%) |
CG31076 | NP_733184.2 | LRR_8 | 11..65 | CDD:290566 | 17/53 (32%) |
leucine-rich repeat | 11..32 | CDD:275378 | 11/18 (61%) | ||
leucine-rich repeat | 33..54 | CDD:275378 | 3/20 (15%) | ||
leucine-rich repeat | 55..79 | CDD:275378 | 6/56 (11%) | ||
leucine-rich repeat | 80..106 | CDD:275378 | 6/31 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1012 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |