Sequence 1: | NP_001285186.1 | Gene: | CG15717 / 32262 | FlyBaseID: | FBgn0030451 | Length: | 252 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001178707.2 | Gene: | Aldh1l2 / 299699 | RGDID: | 1309458 | Length: | 923 | Species: | Rattus norvegicus |
Alignment Length: | 195 | Identity: | 44/195 - (22%) |
---|---|---|---|
Similarity: | 81/195 - (41%) | Gaps: | 36/195 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 RSPQLMVVFEDGDLHSARHQLLQSL-----QNPFAEGSVATLLLQESIADQFVGLVAQDLR---- 95
Fly 96 --PLSQEV----SKHPSYTSTLAKIEELKAKTVQGESLKAGESPV---------LVYDCV--HSY 143
Fly 144 LGNGAT--GVVTVHTFRTAKEAGQLAKRDPLPYGQVS-LWNEKLGCAYELIPRLPSDIVAINCFN 205
Fly 206 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15717 | NP_001285186.1 | DUF1487 | 38..250 | CDD:254173 | 44/195 (23%) |
Aldh1l2 | NP_001178707.2 | FMT_core_FDH_N | 23..225 | CDD:187716 | |
FDH_Hydrolase_C | 228..327 | CDD:187731 | |||
PP-binding | 346..>390 | CDD:395435 | |||
ALDH_F1L_FTFDH | 438..923 | CDD:143458 | 44/195 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1012 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |