DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and Aldh2

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_115792.2 Gene:Aldh2 / 29539 RGDID:69219 Length:519 Species:Rattus norvegicus


Alignment Length:220 Identity:44/220 - (20%)
Similarity:82/220 - (37%) Gaps:50/220 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LQPTAQETKLALIPSAPQWRSPQLMVVFEDGDLHSARHQLLQSLQNPFAEGSV----ATLLLQES 81
            :|..|..:.|..:......:||.  ::..|.|:..|..|...:|.  |.:|..    :...:||.
  Rat   272 IQVAAGSSNLKRVTLELGGKSPN--IIMSDADMDWAVEQAHFALF--FNQGQCCCAGSRTFVQED 332

  Fly    82 IADQFVGLVAQDLRPLSQEVSKHP--SYTSTLAKIEELKAKTVQGESLKAGESPVLVYDCVHSYL 144
            :.|:|   |.:.:......|..:|  |.|....:::|.:.|.:.| .:|:|:.......|     
  Rat   333 VYDEF---VERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKILG-YIKSGQQEGAKLLC----- 388

  Fly   145 GNGATG----------------------------VVTVHTFRTAKEAGQLAKRDPLPYG-QVSLW 180
            |.||..                            |:.:..|:|.:|.  :.:.:...|| ..:::
  Rat   389 GGGAAADRGYFIQPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEV--VGRANNSKYGLAAAVF 451

  Fly   181 NEKLGCAYELIPRLPSDIVAINCFN 205
            .:.|..|..|...|.:..|.|||::
  Rat   452 TKDLDKANYLSQALQAGTVWINCYD 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 41/203 (20%)
Aldh2NP_115792.2 ALDH_F1AB_F2_RALDH1 33..513 CDD:143459 44/220 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.