DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and Aldh1l2

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_705771.2 Gene:Aldh1l2 / 216188 MGIID:2444680 Length:923 Species:Mus musculus


Alignment Length:193 Identity:45/193 - (23%)
Similarity:83/193 - (43%) Gaps:32/193 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RSPQLMVVFEDGDLHSARHQLLQSL-----QNPFAEGSVATLLLQESIADQFVGLVAQDLR---- 95
            :||  :::|.|.||..|....:.::     :|..|.|   .|.::|:|.|:||..|.::::    
Mouse   698 KSP--LIIFSDCDLEKAVRMGMGAVFFNKGENCIAAG---RLFVEEAIHDEFVTRVVEEIKKMKI 757

  Fly    96 --PLSQEVSKHP-SYTSTLAKIEELKAKTVQ-GESLKAGESPV---------LVYDCV--HSYLG 145
              ||.:.....| ::.:.|.|:.:.....|| |.:|..|...|         .|:..|  |.||.
Mouse   758 GDPLDRSTDHGPQNHRAHLEKLLQYCETGVQEGATLVYGGRQVQRPGFFMEPTVFTGVEDHMYLA 822

  Fly   146 NGAT--GVVTVHTFRTAKEAGQLAKRDPLPYGQVS-LWNEKLGCAYELIPRLPSDIVAINCFN 205
            ...:  .::.:..|:.....|.|.:.:...||..| ::...:..|..:..:|.:..|.||.:|
Mouse   823 KEESFGPIMVISKFQNGDIDGVLQRANNTEYGLASGVFTRDINKAMYVSDKLEAGTVFINTYN 885

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 45/193 (23%)
Aldh1l2NP_705771.2 Fmt 22..326 CDD:223301
FMT_core_FDH_N 23..225 CDD:187716
GART 23..225
FDH_Hydrolase_C 228..327 CDD:187731
PP-binding 346..410 CDD:278949
ALDH_F1L_FTFDH 438..923 CDD:143458 45/193 (23%)
Aldehyde dehydrogenase 438..923 45/193 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.