DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and Aldh5a1

DIOPT Version :9

Sequence 1:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_766120.1 Gene:Aldh5a1 / 214579 MGIID:2441982 Length:523 Species:Mus musculus


Alignment Length:165 Identity:35/165 - (21%)
Similarity:56/165 - (33%) Gaps:55/165 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TAQETKLALIPSAP--------QWRSPQLMVVFEDGDLHSARHQLL--QSLQNPFAEGSVATLLL 78
            |:.:.|..|:...|        .|..|..|:..:.|...:|...::  .:...|::..::|.|..
Mouse   169 TSAKDKRGLVLKQPVGVAAIITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPYSALALAQLAN 233

  Fly    79 QESIADQFVGLVAQDLRPLSQEVSKHPSYTSTLAKIEELKAKTVQGESLKAGESPVLVYDCVH-- 141
            |..|......::     |.|:.                 |||.| ||.|           |..  
Mouse   234 QAGIPAGVYNVI-----PCSRN-----------------KAKEV-GEVL-----------CTDPL 264

  Fly   142 ----SYLGNGATGVVTVH-----TFRTAKEAGQLA 167
                |:.|:.|||.:.:|     ..|.:.|.|.||
Mouse   265 VSKISFTGSTATGKILLHHAANSVKRVSMELGGLA 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 31/143 (22%)
Aldh5a1NP_766120.1 SSADH 66..516 CDD:188167 35/165 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.