DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15717 and alh-3

DIOPT Version :10

Sequence 1:NP_572856.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_502054.2 Gene:alh-3 / 177999 WormBaseID:WBGene00000109 Length:908 Species:Caenorhabditis elegans


Alignment Length:97 Identity:26/97 - (26%)
Similarity:45/97 - (46%) Gaps:17/97 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RSPQLMVVFEDGDLHSARHQLLQSL-----QNPFAEGSVATLLLQESIADQFVGLVAQDLR---- 95
            :||  :::|.|.||..|..|...::     :|..|.|.|   .:.:||.|.||..:.::.:    
 Worm   683 KSP--LIIFADADLEKAVKQACGAVFFNKGENCIAAGRV---FIAKSIHDDFVKKLVEEAKQYQI 742

  Fly    96 --PLSQEVSKHP-SYTSTLAKIEELKAKTVQG 124
              ||.:..:..| ::.:.|.|:.|...|.|.|
 Worm   743 GDPLDRSTAHGPQNHLAHLNKLVEYVEKAVAG 774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15717NP_572856.1 DUF1487 38..250 CDD:254173 26/97 (27%)
alh-3NP_502054.2 FMT_core_FDH_N 1..209 CDD:187716
FDH_Hydrolase_C 214..315 CDD:187731
PP-binding 335..393 CDD:425746
ALDH-SF 423..908 CDD:448367 26/97 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.