DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42237 and Oc90

DIOPT Version :9

Sequence 1:NP_572855.1 Gene:CG42237 / 32261 FlyBaseID:FBgn0250862 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001128237.1 Gene:Oc90 / 690625 RGDID:1593441 Length:539 Species:Rattus norvegicus


Alignment Length:314 Identity:62/314 - (19%)
Similarity:97/314 - (30%) Gaps:117/314 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 TSEAVAKPTLSFSLPQGLQGFPSFQSFTQQIIE------QRSARQMKTYSGKRVSNDSLIMIYYH 139
            :.:||..|      |:|:   |...:.|.||.:      :|.|..:.|.|..:...|      ..
  Rat   250 SGKAVTPP------PRGV---PEKPTDTSQIAQSGEVAGERRADTLTTLSRTKSVQD------LQ 299

  Fly   140 DLTIAVTELGPQKLLLGCELIEIYNDKEGKMLLEGLSHYNRPLEIKFDEMLKLMDQCEHVDKLSY 204
            |:..:.|...|.    ..|:|.|         .:|.:|.:..:     :.::|  :...||..|.
  Rat   300 DIQASRTTSSPG----SAEIIAI---------AKGTTHGSAGI-----KSVRL--EVSSVDNSSR 344

  Fly   205 ASRHKS--KLEGGERSNGGSASATTGGANDGVALKLATNIFPRSPFSLLSGIIPGTKWCGTGDIA 267
            .:..|:  :|......:|||..|         .|.|...:|                 |.|....
  Rat   345 ETTGKACGRLAFLHLGDGGSMKA---------MLHLGEMLF-----------------CLTSHCP 383

  Fly   268 ETYSDLG----------SEMAMDRCCRQHDLCPIKIR---------------AYQNKYELMNDSL 307
            |.:...|          ....:||||..|..|..::|               ...:..:.:..||
  Rat   384 EEFESYGCYCGREGRGVPRDTLDRCCLSHHCCLEQMRQLGCLHGRHSRSSVVCEHHTPKCVGQSL 448

  Fly   308 YTKSHCICDDMLFSCLKMTNTSASQLMGSIYFNL------------VQVPCLDG 349
            ..|..|.||.|           |::.|.|.:||.            ..|.|.||
  Rat   449 CEKLLCACDQM-----------AAECMASAFFNQSLKSPDQPECQGEPVSCEDG 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42237NP_572855.1 PLA2_bee_venom_like 254..348 CDD:153093 25/130 (19%)
Oc90NP_001128237.1 otoconin_90 129..246 CDD:153096
otoconin_90 371..485 CDD:153096 25/141 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.