DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42237 and PLA2G1B

DIOPT Version :9

Sequence 1:NP_572855.1 Gene:CG42237 / 32261 FlyBaseID:FBgn0250862 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_000919.1 Gene:PLA2G1B / 5319 HGNCID:9030 Length:148 Species:Homo sapiens


Alignment Length:111 Identity:25/111 - (22%)
Similarity:45/111 - (40%) Gaps:29/111 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 TTGGANDGVALKLATNIFPRSPF---SLLSGIIPGTK----------WCGTGDIAETYSDLGSEM 277
            |...|:.|::        ||:.:   .::..:|||:.          :||.|.......:|    
Human    11 TVAAADSGIS--------PRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDEL---- 63

  Fly   278 AMDRCCRQHDLCPIKIRAYQN-KYELMNDSLYTKSHCICDDMLFSC 322
              |:||:.||.|..:.:...: |:.|.|...:|.|:. |.....:|
Human    64 --DKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYS-CSGSAITC 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42237NP_572855.1 PLA2_bee_venom_like 254..348 CDD:153093 20/80 (25%)
PLA2G1BNP_000919.1 PA2c 24..146 CDD:214508 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.