DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42237 and CG14507

DIOPT Version :9

Sequence 1:NP_572855.1 Gene:CG42237 / 32261 FlyBaseID:FBgn0250862 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster


Alignment Length:377 Identity:76/377 - (20%)
Similarity:117/377 - (31%) Gaps:137/377 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GSSSRSKKPRHT-KMP---------YNLWLRRRLQLLASLLFCCLLGYLTS---------EAVAK 87
            |:|.||..|... |||         :.|...:|.. .|..:|..:....|:         |...|
  Fly    53 GASMRSANPSFVFKMPSKSNGGGDDFELLTMQRSD-FAEPIFPNISQSATAIDSPSTIPPETSVK 116

  Fly    88 PTLSFSLPQ------GLQGF-----PSFQSFTQQIIEQRSARQMKTYSGKRVSNDSLIMIYYHDL 141
            .:|..| ||      ||.|:     |...|..|   :.|..|...::......::..:....|..
  Fly   117 TSLMVS-PQQDWQQMGLDGWTGELKPPVASLEQ---DHRDTRPPISWQNSYPHDEIRLEFQNHHF 177

  Fly   142 TIAVTELGPQKLLLGCELIEIYNDKEGKMLLEGLSHYNRPLEIKFDEMLKLMDQCEHVDKLSY-- 204
            ...||::         .:|.....|..:|  |.|      :.::...:.::.|...:..|.|:  
  Fly   178 DGRVTDI---------RVITQTTSKPAEM--EDL------MNVQNVYIARVNDPFGYSMKWSFTN 225

  Fly   205 -ASRHKSKLEGGERSNGGSASATTGGANDGVALKLATNIFPRSPFSLLSGIIPGTKWCGTGDIAE 268
             :||.|..|..|:|           |..|...|           :|::.        |.||....
  Fly   226 DSSREKELLPEGDR-----------GKRDVARL-----------YSMIK--------CSTGCDPL 260

  Fly   269 TYSDLGSEM----------AMDRCCRQHDLC--------------PIKIRAYQNKYELMNDSLYT 309
            .|...|...          .:|||||.||.|              |...:.|:.|      .|..
  Fly   261 IYKGYGCYCGFGGHGVPADGIDRCCRVHDKCYGQSNCISYLEYFVPYVWKCYRGK------PLCA 319

  Fly   310 KSH-------------CICDDMLFSCLK---------MTNTSASQLMGSIYF 339
            ..|             |.||..|..|||         :.::|.|:.:.::.|
  Fly   320 VDHGEFGGPDSCAARLCQCDLRLSRCLKRYYCPHRRSICHSSRSRRLQNLIF 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42237NP_572855.1 PLA2_bee_venom_like 254..348 CDD:153093 28/132 (21%)
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 28/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.