DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42237 and GIIIspla2

DIOPT Version :9

Sequence 1:NP_572855.1 Gene:CG42237 / 32261 FlyBaseID:FBgn0250862 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001285008.1 Gene:GIIIspla2 / 31747 FlyBaseID:FBgn0030013 Length:217 Species:Drosophila melanogaster


Alignment Length:94 Identity:42/94 - (44%)
Similarity:57/94 - (60%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 IIPGTKWCGTGDIAE-TYSDLGSEMAMDRCCRQHDLCPIKIRAYQNKYELMNDSLYTKSHCICDD 317
            |.|.|:|||.|::|. ||:|||.....|:|||:||.|.:.|....|:|:|.|...||.|||.||.
  Fly    85 IAPNTRWCGRGNLANGTYNDLGGASKADKCCRKHDHCKMWIDGMSNRYDLFNYRPYTLSHCSCDL 149

  Fly   318 MLFSCLKMTNTSASQLMGSIYFNLVQVPC 346
            ...:||||.....:..:|.::||:||..|
  Fly   150 RFRTCLKMAGDEDANAIGKLFFNVVQTQC 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42237NP_572855.1 PLA2_bee_venom_like 254..348 CDD:153093 42/94 (45%)
GIIIspla2NP_001285008.1 PLA2_bee_venom_like 84..181 CDD:153093 42/94 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447078
Domainoid 1 1.000 92 1.000 Domainoid score I7600
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8069
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D126789at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25517
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.