DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42237 and CG3009

DIOPT Version :9

Sequence 1:NP_572855.1 Gene:CG42237 / 32261 FlyBaseID:FBgn0250862 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001162665.1 Gene:CG3009 / 31402 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster


Alignment Length:232 Identity:67/232 - (28%)
Similarity:104/232 - (44%) Gaps:52/232 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 SNDSLIMIYYHDLTIAV-TELGPQKLLLGCELIEIYNDKEGKMLLEGLSHYNRPLEIKFDEMLKL 192
            ::.|.::|  .|:|::| .||..:...  |::.....|.: :|||:  |...|..::..:.:::|
  Fly    25 TSGSAVLI--SDMTMSVMVELSSRHPF--CKMHTDRGDIQ-RMLLQ--SDPRRIRQVPRESVMEL 82

  Fly   193 MDQCEHVDKLSYASRHKSKLEGGERSNGGSASATTGGANDGVALKLATNIFPRSPFSLLSGIIPG 257
            .:.|                    |..|.......||                     |..|.||
  Fly    83 EEVC--------------------RRQGSYGHEFRGG---------------------LGFIYPG 106

  Fly   258 TKWCGTGDIAETYSDLGSEMAMDRCCRQHDLCPIKIRAYQNKYELMNDSLYTKSHCICDDMLFSC 322
            |||||.|..|.:|.|||:....|||||:||:||..:...:.:..|.|...:|:|||.||.....|
  Fly   107 TKWCGPGTAATSYDDLGAHAREDRCCREHDMCPDVLNVGECRRGLCNRGTFTRSHCDCDARFRRC 171

  Fly   323 LKMTNTSASQLMGSIYFNLVQVPCLDGR---SNHYKF 356
            |:..||..:..:|:|::|:|||.|...|   |.|.:|
  Fly   172 LQAANTETANTLGAIFYNVVQVTCFQERSPCSAHQRF 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42237NP_572855.1 PLA2_bee_venom_like 254..348 CDD:153093 42/93 (45%)
CG3009NP_001162665.1 PLA2_bee_venom_like 102..198 CDD:153093 42/95 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7600
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8069
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D126789at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25517
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.