DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42237 and Pla2g3

DIOPT Version :9

Sequence 1:NP_572855.1 Gene:CG42237 / 32261 FlyBaseID:FBgn0250862 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001099485.1 Gene:Pla2g3 / 289733 RGDID:1305323 Length:506 Species:Rattus norvegicus


Alignment Length:200 Identity:59/200 - (29%)
Similarity:87/200 - (43%) Gaps:24/200 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 DKEGKMLLEGL--SHYNRPLEIKFDE---MLKLMDQCEHVDKLSYASRH-------------KSK 211
            |.:|..|.:.|  :|:...:.|:.||   :......|.| :.|.:|..|             :|:
  Rat    51 DAQGLALFQALWDAHHRLQVCIRQDESELIAAFRALCAH-EPLRHAFIHTPGPELQRALATLQSQ 114

  Fly   212 LEGGERSNGGSASATTGGANDGVALKLATNIFPRSPFSLLSGIIPGTKWCGTGDIAETYSDLGSE 276
            .|...||......|......:........:...|..::     ||||.|||.|:.||..|:||..
  Rat   115 WEACRRSEASPTGAREKRETEHRGAPAGEHQRRRRGWT-----IPGTLWCGVGNSAENASELGMF 174

  Fly   277 MAMDRCCRQHDLCPIKIRAYQNKYELMNDSLYTKSHCICDDMLFSCLKMTNTSASQLMGSIYFNL 341
            ...|.|||:||.||..|...|..|.:.|...:|.|||.||.....||:....|.:.:||..:||:
  Rat   175 HGPDFCCREHDQCPQTISPLQYNYGIRNFRFHTISHCDCDARFQQCLRSQGDSIADIMGVAFFNV 239

  Fly   342 VQVPC 346
            :::||
  Rat   240 LEIPC 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42237NP_572855.1 PLA2_bee_venom_like 254..348 CDD:153093 39/92 (42%)
Pla2g3NP_001099485.1 PLA2_bee_venom_like 151..247 CDD:153093 39/98 (40%)
PLA2_group_III_like 299..424 CDD:153094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12253
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.970

Return to query results.
Submit another query.