DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42237 and CG30503

DIOPT Version :9

Sequence 1:NP_572855.1 Gene:CG42237 / 32261 FlyBaseID:FBgn0250862 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001137612.1 Gene:CG30503 / 246656 FlyBaseID:FBgn0050503 Length:173 Species:Drosophila melanogaster


Alignment Length:107 Identity:43/107 - (40%)
Similarity:56/107 - (52%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 LATNIFPRSPFSLLSGIIPGTKWCGTGDIAETYSDLGSEMAMDRCCRQHDLCPIKIRAYQNKYEL 302
            |.|.|:.....:.||..:|||||||.|:||..|.|||:|..:|.|||.||.|..||...:..:.|
  Fly    11 LLTLIYASHAAAGLSITVPGTKWCGPGNIAANYDDLGTEREVDTCCRAHDNCEEKIPPLEEAFGL 75

  Fly   303 MNDSLYTKSHCICDDMLFSCLKMTNTSASQLMGSIYFNLVQV 344
            .||..:....|.|:....:||.......|..:|.||||..:|
  Fly    76 RNDGFFPIFSCACESAFRNCLTALRNGHSLALGKIYFNTKEV 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42237NP_572855.1 PLA2_bee_venom_like 254..348 CDD:153093 38/91 (42%)
CG30503NP_001137612.1 Phospholip_A2_2 28..121 CDD:368629 38/90 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447079
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8069
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.