DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42237 and Pla2g3

DIOPT Version :9

Sequence 1:NP_572855.1 Gene:CG42237 / 32261 FlyBaseID:FBgn0250862 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_766379.2 Gene:Pla2g3 / 237625 MGIID:2444945 Length:504 Species:Mus musculus


Alignment Length:92 Identity:41/92 - (44%)
Similarity:53/92 - (57%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 IPGTKWCGTGDIAETYSDLGSEMAMDRCCRQHDLCPIKIRAYQNKYELMNDSLYTKSHCICDDML 319
            ||||.|||.|:.||..|:||.....|.|||:||.||..|...|..|.:.|...:|.|||.||...
Mouse   149 IPGTLWCGVGNSAENASELGVFHGPDLCCREHDQCPQTISPLQYNYGIRNFRFHTISHCDCDARF 213

  Fly   320 FSCLKMTNTSASQLMGSIYFNLVQVPC 346
            ..||:....|.|.:||..:||::::||
Mouse   214 QQCLRSQGDSISDIMGVAFFNVLEIPC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42237NP_572855.1 PLA2_bee_venom_like 254..348 CDD:153093 41/92 (45%)
Pla2g3NP_766379.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..143
Phospholipase A2-like. /evidence=ECO:0000250|UniProtKB:Q9NZ20 146..287 41/92 (45%)
PLA2_bee_venom_like 147..243 CDD:153093 41/92 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..350
PLA2_group_III_like 295..422 CDD:153094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8069
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.920

Return to query results.
Submit another query.