powered by:
Protein Alignment CG42237 and Proca1
DIOPT Version :9
Sequence 1: | NP_572855.1 |
Gene: | CG42237 / 32261 |
FlyBaseID: | FBgn0250862 |
Length: | 363 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001355805.1 |
Gene: | Proca1 / 216974 |
MGIID: | 1918274 |
Length: | 307 |
Species: | Mus musculus |
Alignment Length: | 55 |
Identity: | 15/55 - (27%) |
Similarity: | 23/55 - (41%) |
Gaps: | 7/55 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 268 ETYSDL-----GSEMAMDRCCRQHDLCP-IKIRAYQNKYELMNDSLYTKSHCICD 316
::.||| |.....||.|.:|..|| ..|..:.:... .|..::..|.|.|:
Mouse 44 DSSSDLFSFSEGENKETDRRCWKHQHCPGHTIHPFSDCGH-HNRCMHAVSQCDCE 97
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167835945 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12253 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.