DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42237 and Proca1

DIOPT Version :9

Sequence 1:NP_572855.1 Gene:CG42237 / 32261 FlyBaseID:FBgn0250862 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001355805.1 Gene:Proca1 / 216974 MGIID:1918274 Length:307 Species:Mus musculus


Alignment Length:55 Identity:15/55 - (27%)
Similarity:23/55 - (41%) Gaps:7/55 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 ETYSDL-----GSEMAMDRCCRQHDLCP-IKIRAYQNKYELMNDSLYTKSHCICD 316
            ::.|||     |.....||.|.:|..|| ..|..:.:... .|..::..|.|.|:
Mouse    44 DSSSDLFSFSEGENKETDRRCWKHQHCPGHTIHPFSDCGH-HNRCMHAVSQCDCE 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42237NP_572855.1 PLA2_bee_venom_like 254..348 CDD:153093 15/55 (27%)
Proca1NP_001355805.1 PLA2_group_III_like 30..123 CDD:153094 15/55 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..155
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..307
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835945
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12253
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.