DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42237 and PROCA1

DIOPT Version :9

Sequence 1:NP_572855.1 Gene:CG42237 / 32261 FlyBaseID:FBgn0250862 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001353230.1 Gene:PROCA1 / 147011 HGNCID:28600 Length:364 Species:Homo sapiens


Alignment Length:101 Identity:27/101 - (26%)
Similarity:48/101 - (47%) Gaps:13/101 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 LLSGIIPGTKWCGTGDIAETYSDLGSEMAMDRCCRQHDLCPIKIRAYQNKYELMNDSLYTKS--H 312
            ||:|:...|      |:: |:|: |.....|:||.:|..|...| .|....:.:..||:..|  |
Human    43 LLAGVASST------DVS-TFSE-GDCKEPDKCCWRHKQCTGHI-IYPFASDCVRHSLHLHSVNH 98

  Fly   313 CICDDMLFSCLKMTNTSASQLMGSIYFNLVQVPCLD 348
            |.|:..|..  ...::|:|:..|....::::.||.:
Human    99 CNCNSRLKD--SSEDSSSSRGAGPTCSHVIESPCFE 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42237NP_572855.1 PLA2_bee_venom_like 254..348 CDD:153093 24/95 (25%)
PROCA1NP_001353230.1 PLA2_group_III_like 33..132 CDD:153094 27/99 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145867
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.